(data stored in ACNUC1104 zone)

EMBL: CP001966.PE77

CP001966.PE77        Location/Qualifiers
FT   CDS             82495..83697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0077"
FT                   /product="glycoside hydrolase family 5"
FT                   /note="PFAM: glycoside hydrolase family 5; KEGG:
FT                   psa:PST_2494 endoglucanase precursor(endo-1,4-
FT                   beta-glucanase)protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76731"
FT                   /db_xref="GOA:D5UPW3"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPW3"
FT                   /inference="protein motif:PFAM:PF00150"
FT                   /protein_id="ADG76731.1"
FT                   /translation="MSRIFRRLIPLFVVIVLVVTSAALPTRRAVDDSTDGQRGINVTTL
FT                   LSQAITISGYPDLTDTGEPQASYDALAAVGHRLIRLPIDWNFLQPNLDKGDERFYSAYW
FT                   RAIKAEIGKIKKAGLKAVLDLHNGCEWTKPGSSEPPLVCGAGLSLDVTTGVWRTISEEF
FT                   KNEPAVVAYDLFNEPTKFTPPSIPNEAGKQAYSVYQAHVNAIVAALRAQGDRKEIWVES
FT                   LCCSIGLDINNTDPDGGWVVDPIKRIVYSLHMYPVGFDADAGLGEEFNPAKLDPNYEEP
FT                   KGKPWSNRGYVRGFLRRLDGFGSWCKRTGEQCSIGEVGWYSRGQAKDSVSRWNELGDEW
FT                   YNIADYYGLAVTYYGASSASVSPLWVYDAPGPSSWFPARGMTQKQSQASVIEKQSHLSK
FT                   P"
     MSRIFRRLIP LFVVIVLVVT SAALPTRRAV DDSTDGQRGI NVTTLLSQAI TISGYPDLTD        60
     TGEPQASYDA LAAVGHRLIR LPIDWNFLQP NLDKGDERFY SAYWRAIKAE IGKIKKAGLK       120
     AVLDLHNGCE WTKPGSSEPP LVCGAGLSLD VTTGVWRTIS EEFKNEPAVV AYDLFNEPTK       180
     FTPPSIPNEA GKQAYSVYQA HVNAIVAALR AQGDRKEIWV ESLCCSIGLD INNTDPDGGW       240
     VVDPIKRIVY SLHMYPVGFD ADAGLGEEFN PAKLDPNYEE PKGKPWSNRG YVRGFLRRLD       300
     GFGSWCKRTG EQCSIGEVGW YSRGQAKDSV SRWNELGDEW YNIADYYGLA VTYYGASSAS       360
     VSPLWVYDAP GPSSWFPARG MTQKQSQASV IEKQSHLSKP                             400
//

If you have problems or comments...

PBIL Back to PBIL home page