(data stored in ACNUC1104 zone)

EMBL: CP001966.PE8

CP001966.PE8         Location/Qualifiers
FT   CDS             9357..9899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0008"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   rer:RER_00050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76662"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR023007"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPB0"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ADG76662.1"
FT                   /translation="MTGPNNDGQLHGSDIARRALEEARAAAKAAGKSVGRGNSAPMTGG
FT                   VRRLRQGSKRWSGPAPDGRDPQRFGALIGGIAKARGWDKKVSEGTVLGCWDTVVGADVA
FT                   AHAQAVSLREKVLYVSAESTAWATQLRLMQPQLLAKINAAVGQGVVTSLTITGPSAPSW
FT                   RKGPLHVPGRGPRDTYG"
     MTGPNNDGQL HGSDIARRAL EEARAAAKAA GKSVGRGNSA PMTGGVRRLR QGSKRWSGPA        60
     PDGRDPQRFG ALIGGIAKAR GWDKKVSEGT VLGCWDTVVG ADVAAHAQAV SLREKVLYVS       120
     AESTAWATQL RLMQPQLLAK INAAVGQGVV TSLTITGPSA PSWRKGPLHV PGRGPRDTYG       180
//

If you have problems or comments...

PBIL Back to PBIL home page