(data stored in ACNUC1104 zone)

EMBL: CP001966.PE81

CP001966.PE81        Location/Qualifiers
FT   CDS             complement(87293..89548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0081"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: mmi:MMAR_0264 cation transporter p-type ATPase
FT                   A CtpA; TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76735"
FT                   /db_xref="GOA:D5UPW7"
FT                   /db_xref="InterPro:IPR000579"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPW7"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADG76735.1"
FT                   /translation="MTDLQSAAPPASADESADATAEAQRTFLDVGGMTCAACVGRVERK
FT                   LNKLDGVRAVVNLATRTATVEHAPTVTVEQLTGTVEAAGYTAAPKSPNPRRAMLAEERE
FT                   RRDVLRRLVVSLVLFVPAADLSIVLAIIPSTRFPGWQWVLLALSLPVVTWGAWPLHKKA
FT                   WQGARHGAATMDTLVSVGIISATAWSVVTVLTPGRQRPDPHGLWNAIVQSDPIYLEVAM
FT                   GVTVFVLAGRYFEASARAKAASALRDLSTRGARDVSVLVRDGSELRIPIGELREDQVFV
FT                   VRPGETIATDGVVESGSAFVDNSAMTGESRPVPAGPGDRVVGGTVCQDGRLTVRAIAVG
FT                   EDTTFAAMLRLVEDAQATKARMQRLADRVSAVFVPCVFAIAALTFAGWMLFGGSIDDAV
FT                   KAAIAVLVIACPCALGLATPVAFMVASGRGAQLGVYVRGHQALEATESIDTVVFDKTGT
FT                   VTTGLLEVAAIAVADGFTEAQVLRLAGAVETASEHAVARAVVARAGADLPAVEDFRAVP
FT                   GLGATGTVDGRTVRVGNPRFVSPGVLAPAVDAAAEAGRTVAVVEVDGAVAAVMEIADTI
FT                   KPDARAAITRLHEAGITTVLLTGDNAAAAAKVAAAVGIDDIRSDVLPEGKVAEIRALQA
FT                   EGRRVAMVGDGVNDGPALAAADLGLAMGTGTDVAQGAADVVLMREELSAVPDALGLARA
FT                   TLKTIKTNLVWAFGYNVAAIPIAAAGLLNPLISAAAMSFSSFFVVWNSLRLRRFGSR"
     MTDLQSAAPP ASADESADAT AEAQRTFLDV GGMTCAACVG RVERKLNKLD GVRAVVNLAT        60
     RTATVEHAPT VTVEQLTGTV EAAGYTAAPK SPNPRRAMLA EERERRDVLR RLVVSLVLFV       120
     PAADLSIVLA IIPSTRFPGW QWVLLALSLP VVTWGAWPLH KKAWQGARHG AATMDTLVSV       180
     GIISATAWSV VTVLTPGRQR PDPHGLWNAI VQSDPIYLEV AMGVTVFVLA GRYFEASARA       240
     KAASALRDLS TRGARDVSVL VRDGSELRIP IGELREDQVF VVRPGETIAT DGVVESGSAF       300
     VDNSAMTGES RPVPAGPGDR VVGGTVCQDG RLTVRAIAVG EDTTFAAMLR LVEDAQATKA       360
     RMQRLADRVS AVFVPCVFAI AALTFAGWML FGGSIDDAVK AAIAVLVIAC PCALGLATPV       420
     AFMVASGRGA QLGVYVRGHQ ALEATESIDT VVFDKTGTVT TGLLEVAAIA VADGFTEAQV       480
     LRLAGAVETA SEHAVARAVV ARAGADLPAV EDFRAVPGLG ATGTVDGRTV RVGNPRFVSP       540
     GVLAPAVDAA AEAGRTVAVV EVDGAVAAVM EIADTIKPDA RAAITRLHEA GITTVLLTGD       600
     NAAAAAKVAA AVGIDDIRSD VLPEGKVAEI RALQAEGRRV AMVGDGVNDG PALAAADLGL       660
     AMGTGTDVAQ GAADVVLMRE ELSAVPDALG LARATLKTIK TNLVWAFGYN VAAIPIAAAG       720
     LLNPLISAAA MSFSSFFVVW NSLRLRRFGS R                                      751
//

If you have problems or comments...

PBIL Back to PBIL home page