(data stored in ACNUC1104 zone)

EMBL: CP001966.PE83

CP001966.PE83        Location/Qualifiers
FT   CDS             complement(90889..91491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0083"
FT                   /product="FMN-binding negative transcriptional regulator"
FT                   /note="PFAM: Negative transcriptional regulator; KEGG:
FT                   pmy:Pmen_0131 FMN-binding negative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76737"
FT                   /db_xref="GOA:D5UPW9"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPW9"
FT                   /inference="protein motif:PFAM:PF04299"
FT                   /protein_id="ADG76737.1"
FT                   /translation="MYVAAPDRSDDERARAMVAAAGIGTVFSASGGLHASTLPLLWEGD
FT                   TVIAHLATANRHWRGLDGAEVLIVVTGPDAYVSPGWYPSKAAHGRAVPTWNYSEVQLRG
FT                   RASIHEDAAACRAIVARLTARHERNRPEPWGLDDAPPAYIEQQLKAIVGLTVEVTAVAA
FT                   KQKWSRGRSAEDIAGVQTALDSADPRAGAEMRRARGL"
     MYVAAPDRSD DERARAMVAA AGIGTVFSAS GGLHASTLPL LWEGDTVIAH LATANRHWRG        60
     LDGAEVLIVV TGPDAYVSPG WYPSKAAHGR AVPTWNYSEV QLRGRASIHE DAAACRAIVA       120
     RLTARHERNR PEPWGLDDAP PAYIEQQLKA IVGLTVEVTA VAAKQKWSRG RSAEDIAGVQ       180
     TALDSADPRA GAEMRRARGL                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page