(data stored in ACNUC1104 zone)

EMBL: CP001966.PE85

CP001966.PE85        Location/Qualifiers
FT   CDS             92044..92703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0085"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sen:SACE_3479
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76739"
FT                   /db_xref="GOA:D5UPX1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPX1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG76739.1"
FT                   /translation="MNVSGATTSLESDVVSPGRNDQTAQSILSAAVASIGSVGISRTTM
FT                   EHVANLAGIGVATVYRRFNRKDNLVQQAIRYEAEQLLKTIEQQIAGLPTVEEALTEGFV
FT                   AFLREAHRRPLIRGIGDGNVVVGLPMIAQGGAMLIEIGRTFAANIIEGFQDKGDLPEFD
FT                   PKPIAEIFARVGHSVLLAPDGLISFDDPYAAGRVVRECLMPAIAAQTAAAATEGAS"
     MNVSGATTSL ESDVVSPGRN DQTAQSILSA AVASIGSVGI SRTTMEHVAN LAGIGVATVY        60
     RRFNRKDNLV QQAIRYEAEQ LLKTIEQQIA GLPTVEEALT EGFVAFLREA HRRPLIRGIG       120
     DGNVVVGLPM IAQGGAMLIE IGRTFAANII EGFQDKGDLP EFDPKPIAEI FARVGHSVLL       180
     APDGLISFDD PYAAGRVVRE CLMPAIAAQT AAAATEGAS                              219
//

If you have problems or comments...

PBIL Back to PBIL home page