(data stored in ACNUC1104 zone)

EMBL: CP001966.PE9

CP001966.PE9         Location/Qualifiers
FT   CDS             10151..12217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0009"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: nfa:nfa60 DNA gyrase subunit B; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   DNA gyrase subunit B domain protein; TOPRIM domain protein;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76663"
FT                   /db_xref="GOA:D5UPB1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPB1"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADG76663.1"
FT                   /translation="MAADNNAGKSGSGNYGADSIKQLEGLEAVRKRPGMYIGTTGPRGL
FT                   HHMIWEVVDNSVDEAMAGHATRVDVKLRADGGVEVIDDGRGIPVAMHAKGIPTVQLVLT
FT                   SLHAGGKFDSDAYAVSGGLHGVGISVVNALSSRVEVEIDVDGFHWQQNFHWDDAKRDSV
FT                   AEDLIKGEPTTRTGTTVRFWADPKVFTETTHYDFETVSRRLQEMAFLNKGLTITLTDER
FT                   PVAIEVPDEDITEEAPSAHEEDVAAALAEVAPKKRERIFHYPDGLVDYVKHINARTSKS
FT                   PIHASIISFEGKEKGHEIEIAMQWNSGYSESVHTFANTINTHEGGTHEEGFRTALTGVV
FT                   KAYAKDKKLVKEKDGELSGDDIREGLAAVISVKVAEPQFEGQTKTKLGNTEVKSFVQKV
FT                   CREQLQFWFDSNPADAKTIVQKAAASAQARLAARKARELVRRKSATDIGGLPGKLADCR
FT                   SNDPDKCEVYIVEGDSAGGSAKSGRDSMYQAILPIRGKIINVEKARIDKVLKNTEVQSI
FT                   ITAFGTGIHDEFDIAKLRYKKIVLMADADVDGQHISTLLLTLLFRFMRPLVEHGHVYLA
FT                   QPPLYKLKWQKGAEPEFAYSDAERDALLAEGLKSGKKINKDDGIQRYKGLGEMNAKELW
FT                   ETTMDPTVRVLKQVTLDDAAAADELFSILMGEDVVARRSFIARNAKDVRFLDV"
     MAADNNAGKS GSGNYGADSI KQLEGLEAVR KRPGMYIGTT GPRGLHHMIW EVVDNSVDEA        60
     MAGHATRVDV KLRADGGVEV IDDGRGIPVA MHAKGIPTVQ LVLTSLHAGG KFDSDAYAVS       120
     GGLHGVGISV VNALSSRVEV EIDVDGFHWQ QNFHWDDAKR DSVAEDLIKG EPTTRTGTTV       180
     RFWADPKVFT ETTHYDFETV SRRLQEMAFL NKGLTITLTD ERPVAIEVPD EDITEEAPSA       240
     HEEDVAAALA EVAPKKRERI FHYPDGLVDY VKHINARTSK SPIHASIISF EGKEKGHEIE       300
     IAMQWNSGYS ESVHTFANTI NTHEGGTHEE GFRTALTGVV KAYAKDKKLV KEKDGELSGD       360
     DIREGLAAVI SVKVAEPQFE GQTKTKLGNT EVKSFVQKVC REQLQFWFDS NPADAKTIVQ       420
     KAAASAQARL AARKARELVR RKSATDIGGL PGKLADCRSN DPDKCEVYIV EGDSAGGSAK       480
     SGRDSMYQAI LPIRGKIINV EKARIDKVLK NTEVQSIITA FGTGIHDEFD IAKLRYKKIV       540
     LMADADVDGQ HISTLLLTLL FRFMRPLVEH GHVYLAQPPL YKLKWQKGAE PEFAYSDAER       600
     DALLAEGLKS GKKINKDDGI QRYKGLGEMN AKELWETTMD PTVRVLKQVT LDDAAAADEL       660
     FSILMGEDVV ARRSFIARNA KDVRFLDV                                          688
//

If you have problems or comments...

PBIL Back to PBIL home page