(data stored in ACNUC1104 zone)

EMBL: CP001966.PE91

CP001966.PE91        Location/Qualifiers
FT   CDS             complement(96809..97504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0091"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro03732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76745"
FT                   /db_xref="GOA:D5UPX7"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPX7"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro03732"
FT                   /protein_id="ADG76745.1"
FT                   /translation="MQRARLVIIAGAIFYSAWIFAPTMGSRLNGLRSYVSEVAATGQPY
FT                   AHFFRGTDLLAGTCFVVGAALWWRAARPSSRFAWGWMAGMIMLGVGTISDALLPLSCTP
FT                   TSDAACAFREANGEVPFTHLAHAYSSGIAGTGGAVAVLAWAAWLLRGGNDGALRTARPL
FT                   TVAAFGAGMTYLITTVWTLAAMAITDPELYLGLAQRLQIAGITSWLVLIALPVGKRSAP
FT                   PDPPRPAPS"
     MQRARLVIIA GAIFYSAWIF APTMGSRLNG LRSYVSEVAA TGQPYAHFFR GTDLLAGTCF        60
     VVGAALWWRA ARPSSRFAWG WMAGMIMLGV GTISDALLPL SCTPTSDAAC AFREANGEVP       120
     FTHLAHAYSS GIAGTGGAVA VLAWAAWLLR GGNDGALRTA RPLTVAAFGA GMTYLITTVW       180
     TLAAMAITDP ELYLGLAQRL QIAGITSWLV LIALPVGKRS APPDPPRPAP S                231
//

If you have problems or comments...

PBIL Back to PBIL home page