(data stored in ACNUC1104 zone)

EMBL: CP001966.PE92

CP001966.PE92        Location/Qualifiers
FT   CDS             complement(97515..98438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0092"
FT                   /product="Cytochrome c oxidase caa3-type, assembly factor
FT                   CtaG-related protein"
FT                   /note="PFAM: Cytochrome c oxidase caa3-type, assembly
FT                   factor CtaG-related; KEGG: mva:Mvan_3709 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76746"
FT                   /db_xref="GOA:D5UPX8"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPX8"
FT                   /inference="protein motif:PFAM:PF09678"
FT                   /protein_id="ADG76746.1"
FT                   /translation="MPPPPAAPPTILGMLGWQPPSLPLLPLVAAIAVVVYLIGVKRVRA
FT                   QGRHWPVARVISFLLGCLALAAVTGLKIEAYSWHLFSAFMFQQLTLSILIPPLLVGGAP
FT                   GVLLLRATPHRGLGKVVLGAALGLLRSRAPRILLHSGFTIPLFLISYYGVYLTGIIDAV
FT                   GGNWFGHTGLQVFFLGAGLLFILPIMSVGPLPGRDSWLMRFFDIFIEMPLHVFIGVTLM
FT                   MATTPMITMFAFPPPEWGIDPVRDQTIAGALAWSYGEPVAMVTVCIFALRWRRAEKQDS
FT                   ERAGADVREDDERAAYNAYLEQLRGR"
     MPPPPAAPPT ILGMLGWQPP SLPLLPLVAA IAVVVYLIGV KRVRAQGRHW PVARVISFLL        60
     GCLALAAVTG LKIEAYSWHL FSAFMFQQLT LSILIPPLLV GGAPGVLLLR ATPHRGLGKV       120
     VLGAALGLLR SRAPRILLHS GFTIPLFLIS YYGVYLTGII DAVGGNWFGH TGLQVFFLGA       180
     GLLFILPIMS VGPLPGRDSW LMRFFDIFIE MPLHVFIGVT LMMATTPMIT MFAFPPPEWG       240
     IDPVRDQTIA GALAWSYGEP VAMVTVCIFA LRWRRAEKQD SERAGADVRE DDERAAYNAY       300
     LEQLRGR                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page