(data stored in ACNUC1104 zone)

EMBL: CP001966.PE96

CP001966.PE96        Location/Qualifiers
FT   CDS             102709..103356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_19470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76750"
FT                   /db_xref="GOA:D5UPY2"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPY2"
FT                   /inference="similar to AA sequence:KEGG:RER_19470"
FT                   /protein_id="ADG76750.1"
FT                   /translation="MLMNPRLWAAASVAAGSFLALAALYLVLVGTATGQYVDHEVMLRV
FT                   SAAFGVEFPTSGWFGDMQMPLLLVGFATTAVLVAASRSVRTAVEAAAVLLLTLGGAYVL
FT                   KALLERPSFGVGPMINSFPSNTVAVFAALAAVAFITAPSALRSIVLSYALGVGAVASVT
FT                   VIALQWHRPGDVLGAWLVAACAAGAVRAYGAAWSAETILRRPVGGRTAAHRG"
     MLMNPRLWAA ASVAAGSFLA LAALYLVLVG TATGQYVDHE VMLRVSAAFG VEFPTSGWFG        60
     DMQMPLLLVG FATTAVLVAA SRSVRTAVEA AAVLLLTLGG AYVLKALLER PSFGVGPMIN       120
     SFPSNTVAVF AALAAVAFIT APSALRSIVL SYALGVGAVA SVTVIALQWH RPGDVLGAWL       180
     VAACAAGAVR AYGAAWSAET ILRRPVGGRT AAHRG                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page