(data stored in ACNUC30630 zone)

EMBL: CP001977.ASPA

CP001977.ASPA        Location/Qualifiers
FT   CDS             108899..110371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="HMPREF0675_3097"
FT                   /product="aspartate ammonia-lyase"
FT                   /EC_number="4.3.1.1"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00839"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3097"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99478"
FT                   /db_xref="GOA:D4HEQ4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEQ4"
FT                   /protein_id="ADD99478.1"
FT                   /translation="MTEIRIEEDLLGKREISNEHYYGIHTLRALENFQISRGCMNDEPD
FT                   FIRGMVQVKKATTLTNKQLKVLPSDVADAIVAACDAILDDGRCMDQFPTDSFQGGAGTS
FT                   INMNTNEVVANLALEMLGYPKGTYDVIHPNDDVNKSQSTNDAYPTGFRLGVYALLEGLK
FT                   RAVADLADSFDAKAEEFADVLKMGRTQLQDAVPMTLGEEFDGYAHNIRAELDRLDIGSD
FT                   LLVEVNLGGTAIGTRINTPDGYAELAAEKLAEVTGYPIRPSTNLMESSYDNGAYIAVHS
FT                   IIKRLAAKISKICNDLRLLSSGPRAGLKEINLPEMQAGSSIMPAKVNPVIPEVVNQICF
FT                   KVFGNDVTVCFAAEAGQLELNVMEPALSQAMFESIHLLTNACDTLRSKCIDGITANVER
FT                   CREYVTNSIGIVTYLNDVIGHHQGDLIGEEAARTGKSVREVVLEHDLIPEERLDEIMST
FT                   QNFLHPRYSGRTYEPSDRGLPEDPRTFVSERC"
     MTEIRIEEDL LGKREISNEH YYGIHTLRAL ENFQISRGCM NDEPDFIRGM VQVKKATTLT        60
     NKQLKVLPSD VADAIVAACD AILDDGRCMD QFPTDSFQGG AGTSINMNTN EVVANLALEM       120
     LGYPKGTYDV IHPNDDVNKS QSTNDAYPTG FRLGVYALLE GLKRAVADLA DSFDAKAEEF       180
     ADVLKMGRTQ LQDAVPMTLG EEFDGYAHNI RAELDRLDIG SDLLVEVNLG GTAIGTRINT       240
     PDGYAELAAE KLAEVTGYPI RPSTNLMESS YDNGAYIAVH SIIKRLAAKI SKICNDLRLL       300
     SSGPRAGLKE INLPEMQAGS SIMPAKVNPV IPEVVNQICF KVFGNDVTVC FAAEAGQLEL       360
     NVMEPALSQA MFESIHLLTN ACDTLRSKCI DGITANVERC REYVTNSIGI VTYLNDVIGH       420
     HQGDLIGEEA ARTGKSVREV VLEHDLIPEE RLDEIMSTQN FLHPRYSGRT YEPSDRGLPE       480
     DPRTFVSERC                                                              490
//

If you have problems or comments...

PBIL Back to PBIL home page