(data stored in ACNUC30630 zone)

EMBL: CP001977.CBIN

CP001977.CBIN        Location/Qualifiers
FT   CDS             494917..495351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiN"
FT                   /locus_tag="HMPREF0675_3466"
FT                   /product="cobalt transport protein"
FT                   /note="identified by match to protein family HMM PF02553"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3466"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99625"
FT                   /db_xref="GOA:D4HBN9"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBN9"
FT                   /protein_id="ADD99625.1"
FT                   /translation="MPENTVAKAHRDSSLTSKSKWVTPVIIVLVVGLFIISMVLGAKKT
FT                   SGGEEGFGGTDDAAAEAAEKAGAKKWIKPIFEPNSSEVESGLFALQAALGAGIVGYALG
FT                   RMSGRTKGREEAERASDLNSVDDVPQAAVTSSEDTSTSKS"
     MPENTVAKAH RDSSLTSKSK WVTPVIIVLV VGLFIISMVL GAKKTSGGEE GFGGTDDAAA        60
     EAAEKAGAKK WIKPIFEPNS SEVESGLFAL QAALGAGIVG YALGRMSGRT KGREEAERAS       120
     DLNSVDDVPQ AAVTSSEDTS TSKS                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page