(data stored in ACNUC30630 zone)

EMBL: CP001977.COBH

CP001977.COBH        Location/Qualifiers
FT   CDS             complement(493282..493935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobH"
FT                   /locus_tag="HMPREF0675_3464"
FT                   /product="precorrin-8X methylmutase"
FT                   /EC_number="5.4.1.2"
FT                   /note="identified by match to protein family HMM PF02570"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3464"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99221"
FT                   /db_xref="GOA:D4HBN7"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBN7"
FT                   /protein_id="ADD99221.1"
FT                   /translation="MAHEYVNNGSDIYRESFRIIRSEANLDRFPTDVEGVVVRMIHAAA
FT                   DPAIADDIAFTPAVVTAARRALGDGAPILCDSSMTATGIIRSRLPRDNETICYIKDPRL
FT                   ADIAQAKDMTKTCAAVDLWTEEGKLDGAIVAIGNAPTALFRVLEVCEETGARPAAVVGI
FT                   PVGFVGAAESKQALVDSKLGLEYLTLLGRRGGSAIAVAAVNAIASTDELTNSHR"
     MAHEYVNNGS DIYRESFRII RSEANLDRFP TDVEGVVVRM IHAAADPAIA DDIAFTPAVV        60
     TAARRALGDG APILCDSSMT ATGIIRSRLP RDNETICYIK DPRLADIAQA KDMTKTCAAV       120
     DLWTEEGKLD GAIVAIGNAP TALFRVLEVC EETGARPAAV VGIPVGFVGA AESKQALVDS       180
     KLGLEYLTLL GRRGGSAIAV AAVNAIASTD ELTNSHR                                217
//

If you have problems or comments...

PBIL Back to PBIL home page