(data stored in ACNUC30630 zone)

EMBL: CP001977.COBJ

CP001977.COBJ        Location/Qualifiers
FT   CDS             483286..485835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobJ"
FT                   /locus_tag="HMPREF0675_3455"
FT                   /product="precorrin-3B C(17)-methyltransferase"
FT                   /EC_number="2.1.1.131"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift; identified by match to protein family HMM
FT                   PF00590; match to protein family HMM PF01890; match to
FT                   protein family HMM TIGR01466; match to protein family HMM
FT                   TIGR02467"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3455"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01139"
FT                   /db_xref="GOA:D4HB95"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB95"
FT                   /protein_id="ADE01139.1"
FT                   /translation="MIRVHGYLGTISDALREEVTQADLVVGGQRHLDALAVPDDKRQKL
FT                   GLIGPAIERIQSLPDDANVVVIASGDPLFFGVVRRIRQAGLRVEVVTAPTSLQAAFAAV
FT                   ALPWDDAQFVSSHSKDIETAVRLAKIHPKVGVLTAPNRGLAELVDGLAGRGKTFVLAEK
FT                   IGEEGQRVRVLDEDAAKAVIADEDILSPNVVLVLEHHPDSPEALGVNPELAGDVNVNGP
FT                   DAPQPGSDTNPDGSDRDPIIGQIINSDAAVAHAEAIDHALKRETKKYVGPSRTGLAAAW
FT                   GECDLIISHLALGATTRIIAPLLESKKTDPGVVVVDEAGRFAIPLVGGHVGGANELSRT
FT                   VAEALSGTAVVSTATDSLGVPALDQLGWAYEGDVAGVTGSIIAGRPVLVVREQPWPLPP
FT                   LPKNVTEDAETPAARVIVSERVAERVFADHGDDLPTVVLHPSCLVVGMGCNKGTEVESL
FT                   RQLLVKTLEDNGLALGSVTRLVSHEVKAGELGLVKLANQLGVEYRTESAEALAAHDVPT
FT                   PSDVVAREVGTPSVSEAAVLCQGAELLVHKTKTSDATCAIGRIPAHGHLSVVGLGPGSR
FT                   DLLTPRAVEAIRNATFVAGYAPYVRQIRDLVRPGATILATKMGTEEERTQAAIEATRDG
FT                   RNVAFVCGGDPAIYAMASPTLEMGTDGIDVEIVPGVTAELAISAILGAPLGHDHATISL
FT                   SDLHTDWDLILKRVKAAAEGDLVTTFYNPRSRTRTHQLPDALAIMAEHRPPSTPVALVS
FT                   HAERRQQQVIMSTLEEFKPEWCGMTTLVVVGSTTTKYVSSGDGRRLMVTPRDYHWMDGH
FT                   VCSEARKNYTHKDLPRADEERRISPSLRFTPLSCLSP"
     MIRVHGYLGT ISDALREEVT QADLVVGGQR HLDALAVPDD KRQKLGLIGP AIERIQSLPD        60
     DANVVVIASG DPLFFGVVRR IRQAGLRVEV VTAPTSLQAA FAAVALPWDD AQFVSSHSKD       120
     IETAVRLAKI HPKVGVLTAP NRGLAELVDG LAGRGKTFVL AEKIGEEGQR VRVLDEDAAK       180
     AVIADEDILS PNVVLVLEHH PDSPEALGVN PELAGDVNVN GPDAPQPGSD TNPDGSDRDP       240
     IIGQIINSDA AVAHAEAIDH ALKRETKKYV GPSRTGLAAA WGECDLIISH LALGATTRII       300
     APLLESKKTD PGVVVVDEAG RFAIPLVGGH VGGANELSRT VAEALSGTAV VSTATDSLGV       360
     PALDQLGWAY EGDVAGVTGS IIAGRPVLVV REQPWPLPPL PKNVTEDAET PAARVIVSER       420
     VAERVFADHG DDLPTVVLHP SCLVVGMGCN KGTEVESLRQ LLVKTLEDNG LALGSVTRLV       480
     SHEVKAGELG LVKLANQLGV EYRTESAEAL AAHDVPTPSD VVAREVGTPS VSEAAVLCQG       540
     AELLVHKTKT SDATCAIGRI PAHGHLSVVG LGPGSRDLLT PRAVEAIRNA TFVAGYAPYV       600
     RQIRDLVRPG ATILATKMGT EEERTQAAIE ATRDGRNVAF VCGGDPAIYA MASPTLEMGT       660
     DGIDVEIVPG VTAELAISAI LGAPLGHDHA TISLSDLHTD WDLILKRVKA AAEGDLVTTF       720
     YNPRSRTRTH QLPDALAIMA EHRPPSTPVA LVSHAERRQQ QVIMSTLEEF KPEWCGMTTL       780
     VVVGSTTTKY VSSGDGRRLM VTPRDYHWMD GHVCSEARKN YTHKDLPRAD EERRISPSLR       840
     FTPLSCLSP                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page