(data stored in ACNUC30630 zone)

EMBL: CP001977.COBM

CP001977.COBM        Location/Qualifiers
FT   CDS             482318..483289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobM"
FT                   /locus_tag="HMPREF0675_3454"
FT                   /product="precorrin-4 C(11)-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR01465"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3454"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00772"
FT                   /db_xref="GOA:D4HB94"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB94"
FT                   /protein_id="ADE00772.1"
FT                   /translation="MSEPQAARPTQHVSEKALEDLDHNVIEPPPVPRRDIPEGAGKVVF
FT                   VGAGPGAPDLVSVRGARVIETADIIIWASSLVHPDMVARHKEGAELIDSASIPLEDLEP
FT                   LYTRARDEGLMVVRVHTGDPSIYGATAEQRDLCRRIGIDFETIPGISAFSAAAARMDVE
FT                   ITVPEVSQSLILTRLEGGRTPMPDGETVASFARHGATMAIYLSAARNKALQEALLEGGY
FT                   LPETPCIIGYAVTWPEEMMFRCDLAHLSETMRNHKLWKHAVVLVGPALAEGPISTRSHL
FT                   YHPGFRHEYRAADAQAHADLKAHGTCGVYHRNSTNPDTKGNS"
     MSEPQAARPT QHVSEKALED LDHNVIEPPP VPRRDIPEGA GKVVFVGAGP GAPDLVSVRG        60
     ARVIETADII IWASSLVHPD MVARHKEGAE LIDSASIPLE DLEPLYTRAR DEGLMVVRVH       120
     TGDPSIYGAT AEQRDLCRRI GIDFETIPGI SAFSAAAARM DVEITVPEVS QSLILTRLEG       180
     GRTPMPDGET VASFARHGAT MAIYLSAARN KALQEALLEG GYLPETPCII GYAVTWPEEM       240
     MFRCDLAHLS ETMRNHKLWK HAVVLVGPAL AEGPISTRSH LYHPGFRHEY RAADAQAHAD       300
     LKAHGTCGVY HRNSTNPDTK GNS                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page