(data stored in ACNUC30630 zone)

EMBL: CP001977.COBQ

CP001977.COBQ        Location/Qualifiers
FT   CDS             479785..481239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobQ"
FT                   /locus_tag="HMPREF0675_3452"
FT                   /product="cobyric acid synthase CobQ"
FT                   /EC_number="6.3.5.10"
FT                   /note="identified by match to protein family HMM PF01656;
FT                   match to protein family HMM PF07685; match to protein
FT                   family HMM TIGR00313"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3452"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00086"
FT                   /db_xref="GOA:D4HB92"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB92"
FT                   /protein_id="ADE00086.1"
FT                   /translation="MTGILVAGTSSDAGKSLVVTALCRVARRRGVDVVPFKAQNMSNNS
FT                   MVCADGSEIGRAQYLQATAAGVTPTSAMNPVLLKPGTDRRSFVVLRGKPGGVLEAGEYT
FT                   TGRRYLAEAAWAAYDELAASHDMVICEGAGSPAEINLRRGDYTNMGLARAKNLPVVLVG
FT                   DIDRGGVLASLFGTWALLDDDDRALLAGYIVNKFRGDDAILAPGLEEITDRTGMPSFGV
FT                   LPWVPGVWLDGEDALEVGRWRHEGDAVDPSSLRVAVVRFPRISNATDVDAMAGETGVDV
FT                   QVTTNPDTCQAADVLVLPGSRSTVSDLEWLRRSGIADVVARRAEQGRTVVGICGGYQML
FT                   CRTILDPDGQETTPGSVVEGLGLLPVEVDFAATKTLALSHGTWRGIEVGGYEIHHGVCR
FT                   SLEDAEAFLDGVHVGPVWGTMWHGAFEHDEFRRTWLADAARHAGSSWRPHSDELGYQAR
FT                   REAMIETLADALEAHVDVDRILHLVR"
     MTGILVAGTS SDAGKSLVVT ALCRVARRRG VDVVPFKAQN MSNNSMVCAD GSEIGRAQYL        60
     QATAAGVTPT SAMNPVLLKP GTDRRSFVVL RGKPGGVLEA GEYTTGRRYL AEAAWAAYDE       120
     LAASHDMVIC EGAGSPAEIN LRRGDYTNMG LARAKNLPVV LVGDIDRGGV LASLFGTWAL       180
     LDDDDRALLA GYIVNKFRGD DAILAPGLEE ITDRTGMPSF GVLPWVPGVW LDGEDALEVG       240
     RWRHEGDAVD PSSLRVAVVR FPRISNATDV DAMAGETGVD VQVTTNPDTC QAADVLVLPG       300
     SRSTVSDLEW LRRSGIADVV ARRAEQGRTV VGICGGYQML CRTILDPDGQ ETTPGSVVEG       360
     LGLLPVEVDF AATKTLALSH GTWRGIEVGG YEIHHGVCRS LEDAEAFLDG VHVGPVWGTM       420
     WHGAFEHDEF RRTWLADAAR HAGSSWRPHS DELGYQARRE AMIETLADAL EAHVDVDRIL       480
     HLVR                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page