(data stored in ACNUC30630 zone)

EMBL: CP001977.DACB

CP001977.DACB        Location/Qualifiers
FT   CDS             336697..338070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacB"
FT                   /locus_tag="HMPREF0675_3304"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="identified by match to protein family HMM PF02113;
FT                   match to protein family HMM TIGR00666"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3304"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00173"
FT                   /db_xref="GOA:D4HA31"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA31"
FT                   /protein_id="ADE00173.1"
FT                   /translation="MPGWVPVTVGIAVVVIVVVAVIVSSLRSGSPARWTGGGILPHRHD
FT                   NTAQAVQPGRGVVAAVAPTTPSAKPVAATIANRVKSAGAAPGVLGADIMDAATGETLYQ
FT                   SGQNSLLTPASNLKVLTAIALLDCTDAGHRYTTKVVANGSALTLVGGGDPYLRSKSSAQ
FT                   HPEYPSMEELAKRTAAALKKAGTTKVTVNFDDTLFTGPDWNGAWPVDNYSDEVTPITSL
FT                   WVDEGMINNSPWNRSKTPAVLATNAFIGSLRSAGITVNGSVSRHKADRSAREIAAVQSV
FT                   PVEDLVTRTLEESDNSAAEVLSRQMALASGKPGSFAGGTQALEEHLKYIGAWQDGAVIQ
FT                   DGSGLSQGNRITASMLSRAWRKVLTTPKLQPVANAVPVGRVSGTLHKRFSDPSTAAGRG
FT                   VVHAKTGSLQGVISMSGWLRDADGRILVASFIINQTDGSARSWLDVVYGNLAGCGCTR"
     MPGWVPVTVG IAVVVIVVVA VIVSSLRSGS PARWTGGGIL PHRHDNTAQA VQPGRGVVAA        60
     VAPTTPSAKP VAATIANRVK SAGAAPGVLG ADIMDAATGE TLYQSGQNSL LTPASNLKVL       120
     TAIALLDCTD AGHRYTTKVV ANGSALTLVG GGDPYLRSKS SAQHPEYPSM EELAKRTAAA       180
     LKKAGTTKVT VNFDDTLFTG PDWNGAWPVD NYSDEVTPIT SLWVDEGMIN NSPWNRSKTP       240
     AVLATNAFIG SLRSAGITVN GSVSRHKADR SAREIAAVQS VPVEDLVTRT LEESDNSAAE       300
     VLSRQMALAS GKPGSFAGGT QALEEHLKYI GAWQDGAVIQ DGSGLSQGNR ITASMLSRAW       360
     RKVLTTPKLQ PVANAVPVGR VSGTLHKRFS DPSTAAGRGV VHAKTGSLQG VISMSGWLRD       420
     ADGRILVASF IINQTDGSAR SWLDVVYGNL AGCGCTR                                457
//

If you have problems or comments...

PBIL Back to PBIL home page