(data stored in ACNUC30630 zone)

EMBL: CP001977.DNAX

CP001977.DNAX        Location/Qualifiers
FT   CDS             279265..282138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="HMPREF0675_3248"
FT                   /product="DNA polymerase III, subunit gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM TIGR02397"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3248"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00355"
FT                   /db_xref="GOA:D4H9J4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9J4"
FT                   /protein_id="ADE00355.1"
FT                   /translation="MDERAPEPGMENEAVEPEVFEQDGPDLFGDEESPRPVMPPDEATP
FT                   DDDLPSDPCDPGLLDGPETPEEPDGLETDEDEEDGADVIERVQELIGEAPDSNPDDDLP
FT                   ELPLALYRRYRPETFDEVIGEDHVIEPLKRAILNNRVNHAYLFSGPRGCGKTTTARILA
FT                   RALNCEQGPTPTPCGTCQSCRDLACGGPGSIDVIEIDAASHGGVDDARDLRERAFFAPV
FT                   HSRYKIYIIDEAHMVTPQGFNALLKLVEEPPPHVKFIFATTEPEKVIGTIRSRTHHYPF
FT                   RLVPPKVLVEYLAELCGKEGIDVDHAVLPLVVRAGGGSVRDSLSVLDQLLGGAADGHVS
FT                   YEQAAALLGYTPEALLDEIVDAFAAGDAHQVFATIDKVIEVGQDPRRFAEDLLRRMRDL
FT                   VIVSAVPDACRSGLIDVSPEQATRLAHQVSGFGAGELTRAAEVLATGLTNMRGTTAPRL
FT                   HLELMCSRILLPGADTDGRGIHARLERLERRIGVSGPVEEVERAERPVTAQPPTRYADT
FT                   PQQASPPQHWPAENLQNPERRSAPEHHDAPSPGQRPSGRPRPSRKDYRPGNQLAEQPPS
FT                   NQHGDDGQMSQGPRQQGGPSTSQRQQPRPQDHQPSQRDRQDTPPAQPQQPSAEQGGRAD
FT                   DAINITTLRREWPQVLEAVKDGGRVAWMVLNQYAQVLEVHGNQATLGFSNIGARENFAA
FT                   GNYPKVLHDAVVKVLGVDLAFTAVVGEPPAAVRPESHPAEFQSGPAAQEPPDDDPWEQG
FT                   PHHQDSTRGGEPSDPTHPGRDPQGRPGDRQAISDDASKDAPPPPVTSSHPSEAGDDDPA
FT                   PDATTEDQSADVRDEVVESGPVAGAPDPDSGGAAEPKPDLVPGQDHVEAAGRAESARQI
FT                   DPGGASSQGRPSAAAVSTAHRWSERAKGSVRPLEVTSRSAQVEEPPDDGGEWDDTVVEE
FT                   SNESPIDLIMRELGGVVIDTDGDSTAR"
     MDERAPEPGM ENEAVEPEVF EQDGPDLFGD EESPRPVMPP DEATPDDDLP SDPCDPGLLD        60
     GPETPEEPDG LETDEDEEDG ADVIERVQEL IGEAPDSNPD DDLPELPLAL YRRYRPETFD       120
     EVIGEDHVIE PLKRAILNNR VNHAYLFSGP RGCGKTTTAR ILARALNCEQ GPTPTPCGTC       180
     QSCRDLACGG PGSIDVIEID AASHGGVDDA RDLRERAFFA PVHSRYKIYI IDEAHMVTPQ       240
     GFNALLKLVE EPPPHVKFIF ATTEPEKVIG TIRSRTHHYP FRLVPPKVLV EYLAELCGKE       300
     GIDVDHAVLP LVVRAGGGSV RDSLSVLDQL LGGAADGHVS YEQAAALLGY TPEALLDEIV       360
     DAFAAGDAHQ VFATIDKVIE VGQDPRRFAE DLLRRMRDLV IVSAVPDACR SGLIDVSPEQ       420
     ATRLAHQVSG FGAGELTRAA EVLATGLTNM RGTTAPRLHL ELMCSRILLP GADTDGRGIH       480
     ARLERLERRI GVSGPVEEVE RAERPVTAQP PTRYADTPQQ ASPPQHWPAE NLQNPERRSA       540
     PEHHDAPSPG QRPSGRPRPS RKDYRPGNQL AEQPPSNQHG DDGQMSQGPR QQGGPSTSQR       600
     QQPRPQDHQP SQRDRQDTPP AQPQQPSAEQ GGRADDAINI TTLRREWPQV LEAVKDGGRV       660
     AWMVLNQYAQ VLEVHGNQAT LGFSNIGARE NFAAGNYPKV LHDAVVKVLG VDLAFTAVVG       720
     EPPAAVRPES HPAEFQSGPA AQEPPDDDPW EQGPHHQDST RGGEPSDPTH PGRDPQGRPG       780
     DRQAISDDAS KDAPPPPVTS SHPSEAGDDD PAPDATTEDQ SADVRDEVVE SGPVAGAPDP       840
     DSGGAAEPKP DLVPGQDHVE AAGRAESARQ IDPGGASSQG RPSAAAVSTA HRWSERAKGS       900
     VRPLEVTSRS AQVEEPPDDG GEWDDTVVEE SNESPIDLIM RELGGVVIDT DGDSTAR          957
//

If you have problems or comments...

PBIL Back to PBIL home page