(data stored in ACNUC30630 zone)

EMBL: CP001977.FHS

CP001977.FHS         Location/Qualifiers
FT   CDS             47388..49097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhs"
FT                   /locus_tag="HMPREF0675_3049"
FT                   /product="formate--tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="identified by match to protein family HMM PF01268"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3049"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00550"
FT                   /db_xref="GOA:D4HEK7"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEK7"
FT                   /protein_id="ADE00550.1"
FT                   /translation="MIGAMTMKSDLEIAREAHLDPIEKVAARAGIDEKYLEPYGRGVAK
FT                   VDLDVVTHNRDHSCGKYVVVTAMTPTPLGEGKTTTAVGLAQGLEKIGKHSVLALRQPSM
FT                   GPTFGIKGGAAGAGYSQVLPMEKLNLHLTGDFHAIGAAHNLLAAMIDNHLHQGNELDIE
FT                   PHSISWRRVVDINDRALRNTIVGLGSRVDGVPRETGFDITAASEVGVILSLATSLSDLR
FT                   ARLGRIVIGYNRSKEPVSAEDLHAAGSMAVILKDALKPNLLQTTENSPVLVHAGPFGNI
FT                   ATGNSSVIADRVGIGCGDYLLTEAGFGADMGAERFFNIKCRIGGMRPDAAVLVATVRAL
FT                   KTHAGRYKVIPGKPLPPAMLEDNPDDVLAGAANLRKHIEIVREFGVSPIVALNVFPTDH
FT                   PDEIDAVRKVAEAAGAHFASSTHVVDGGDGAVDLAHAVVAACDHKADFRYTYDLEDSLV
FT                   EKLTKVATKVYGADGIDIAPAAAKELAHFEDLGYGTFPVVIAKTHLSLSHDPSLKGAPT
FT                   GWRLPVREVRAAVGAGYIYAICGDMRTMPGLGRHPAAERIDIDDNGETIGLF"
     MIGAMTMKSD LEIAREAHLD PIEKVAARAG IDEKYLEPYG RGVAKVDLDV VTHNRDHSCG        60
     KYVVVTAMTP TPLGEGKTTT AVGLAQGLEK IGKHSVLALR QPSMGPTFGI KGGAAGAGYS       120
     QVLPMEKLNL HLTGDFHAIG AAHNLLAAMI DNHLHQGNEL DIEPHSISWR RVVDINDRAL       180
     RNTIVGLGSR VDGVPRETGF DITAASEVGV ILSLATSLSD LRARLGRIVI GYNRSKEPVS       240
     AEDLHAAGSM AVILKDALKP NLLQTTENSP VLVHAGPFGN IATGNSSVIA DRVGIGCGDY       300
     LLTEAGFGAD MGAERFFNIK CRIGGMRPDA AVLVATVRAL KTHAGRYKVI PGKPLPPAML       360
     EDNPDDVLAG AANLRKHIEI VREFGVSPIV ALNVFPTDHP DEIDAVRKVA EAAGAHFASS       420
     THVVDGGDGA VDLAHAVVAA CDHKADFRYT YDLEDSLVEK LTKVATKVYG ADGIDIAPAA       480
     AKELAHFEDL GYGTFPVVIA KTHLSLSHDP SLKGAPTGWR LPVREVRAAV GAGYIYAICG       540
     DMRTMPGLGR HPAAERIDID DNGETIGLF                                         569
//

If you have problems or comments...

PBIL Back to PBIL home page