(data stored in ACNUC30630 zone)

EMBL: CP001977.GLYA

CP001977.GLYA        Location/Qualifiers
FT   CDS             complement(438383..439858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="HMPREF0675_3410"
FT                   /product="glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="identified by match to protein family HMM PF00464"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3410"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00072"
FT                   /db_xref="GOA:D4HB50"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB50"
FT                   /protein_id="ADE00072.1"
FT                   /translation="MSDPRAVDPTARDIAEKLAPAYRTMLDAIAQVEPRIAEATRAELT
FT                   DQRHSLKLIASENYASLPVLATMGTWFSDKYAEGTAGHRFYAGCQNVDTVETIAAEHAC
FT                   ALFGAEHAYVQPHSGIDANLTAYWTILAHHIETPALSEFGARTVNDLTQVDWDTLRHRF
FT                   NDQRAIGMSLDAGGHLTHGFRPNISGKMFDQRSYGTDPQTGLLDYDKVAELAREFKPLV
FT                   IVAGYSAYPRRVNFAKMREIADEVGAVLMVDMAHFAGLVAGKVFTGDENPIPHAQVVTT
FT                   TTHKSLRGPRGGMVLTTKDYADDVDRGCPMVLGGPLSHVMAAKAVALAEARTQTFRDYA
FT                   QRVANNAKALAEGLMKRGVKLVTDGTDNHINLLDVTTSFGLTGRQAEAALLDAGVVTNR
FT                   NSIPTDPNGAWYTSGIRIGTPALTSRGFGPDEFDQVAELIVTTLEATTPMTASTGKPGK
FT                   AKYQIADGVAQKVHDAADELLGNFPLYPGLDLA"
     MSDPRAVDPT ARDIAEKLAP AYRTMLDAIA QVEPRIAEAT RAELTDQRHS LKLIASENYA        60
     SLPVLATMGT WFSDKYAEGT AGHRFYAGCQ NVDTVETIAA EHACALFGAE HAYVQPHSGI       120
     DANLTAYWTI LAHHIETPAL SEFGARTVND LTQVDWDTLR HRFNDQRAIG MSLDAGGHLT       180
     HGFRPNISGK MFDQRSYGTD PQTGLLDYDK VAELAREFKP LVIVAGYSAY PRRVNFAKMR       240
     EIADEVGAVL MVDMAHFAGL VAGKVFTGDE NPIPHAQVVT TTTHKSLRGP RGGMVLTTKD       300
     YADDVDRGCP MVLGGPLSHV MAAKAVALAE ARTQTFRDYA QRVANNAKAL AEGLMKRGVK       360
     LVTDGTDNHI NLLDVTTSFG LTGRQAEAAL LDAGVVTNRN SIPTDPNGAW YTSGIRIGTP       420
     ALTSRGFGPD EFDQVAELIV TTLEATTPMT ASTGKPGKAK YQIADGVAQK VHDAADELLG       480
     NFPLYPGLDL A                                                            491
//

If you have problems or comments...

PBIL Back to PBIL home page