(data stored in ACNUC30630 zone)

EMBL: CP001977.GYRA

CP001977.GYRA        Location/Qualifiers
FT   CDS             11843..14518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="HMPREF0675_3009"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989; match to protein
FT                   family HMM TIGR01063"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3009"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00537"
FT                   /db_xref="GOA:D4HEG8"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEG8"
FT                   /protein_id="ADE00537.1"
FT                   /translation="MADDEKPDEQNQADRQGLVTGRHVGIQPVEIRDEIQNAYLDYAMS
FT                   VIVGRALPDVRDGLKPVHRRVIYAMYDGGYRPDRGWNKCSRVVGDVMGKYHPHGDSAIY
FT                   DTLVRLAQPWAMRYKLVQGQGNFGSQGNDGAAAMRYTECKMAPLAMEMVRDIDQDTVDF
FT                   QPNYDNKETEPVVLPSRFPNLLVNGSSGIAVGMATNIPTHNLREVNEAVQWSLAHPNAS
FT                   HEELLEACMERIKGPDFPGGALIVGRQGIEDAYRTGRGSVTMRAVIDMEEDKKGRQCLV
FT                   VTELPYMCNPDNLATKIADLVNSGRINGIADIRDDSSARTGQRLVIVLKRDAQPRVVMN
FT                   NLYKHTALQDTFGCNMLALVDNVPRTLRLDQFISYWIDHQMEVIRRRTEYRLAQAEKDA
FT                   HIQRALVKALDMLDEVIALIRRSPNTEAASTGLQELLDIDEIQARAILDMQLRRLAALE
FT                   RQKIIDRLEELERLIADYKAILASEDRQREIISTELAEIVDKYGDERRTRIIAADGDFS
FT                   EEDFIPDDDVVVTITRGGYAKRTRTDLYRVQKRGGKGVRGASLRADDEVAQLFTTTNHQ
FT                   WILFFTNMGRVYRTKVWQLPEAGRDARGGHVAGLLSFLPDEKIAQVMTLRSYDDAEYLL
FT                   LATRKGMVKKTALKAYDSSRQAGVIAVNFRTEDDELIGAEQCSAADDVLLISRKGQAIR
FT                   FSAGDDQLRPMGRATSGVTGMKFRGDDELLSMSIIHSDMPEDDRFVFTATGGGYAKRTA
FT                   VSEYRQQGRGGVGIKAMALSEERGSLVGGLVVSEADEIIAIKTSGQITRSAVSEVPAKG
FT                   RSTMGVKFVSVRGGDAVSIIAVNPEHTVEEEVADESVETVEGDATQAQSGEVVRRSDTV
FT                   DGDRAVDTAGNDMKPEDNGE"
     MADDEKPDEQ NQADRQGLVT GRHVGIQPVE IRDEIQNAYL DYAMSVIVGR ALPDVRDGLK        60
     PVHRRVIYAM YDGGYRPDRG WNKCSRVVGD VMGKYHPHGD SAIYDTLVRL AQPWAMRYKL       120
     VQGQGNFGSQ GNDGAAAMRY TECKMAPLAM EMVRDIDQDT VDFQPNYDNK ETEPVVLPSR       180
     FPNLLVNGSS GIAVGMATNI PTHNLREVNE AVQWSLAHPN ASHEELLEAC MERIKGPDFP       240
     GGALIVGRQG IEDAYRTGRG SVTMRAVIDM EEDKKGRQCL VVTELPYMCN PDNLATKIAD       300
     LVNSGRINGI ADIRDDSSAR TGQRLVIVLK RDAQPRVVMN NLYKHTALQD TFGCNMLALV       360
     DNVPRTLRLD QFISYWIDHQ MEVIRRRTEY RLAQAEKDAH IQRALVKALD MLDEVIALIR       420
     RSPNTEAAST GLQELLDIDE IQARAILDMQ LRRLAALERQ KIIDRLEELE RLIADYKAIL       480
     ASEDRQREII STELAEIVDK YGDERRTRII AADGDFSEED FIPDDDVVVT ITRGGYAKRT       540
     RTDLYRVQKR GGKGVRGASL RADDEVAQLF TTTNHQWILF FTNMGRVYRT KVWQLPEAGR       600
     DARGGHVAGL LSFLPDEKIA QVMTLRSYDD AEYLLLATRK GMVKKTALKA YDSSRQAGVI       660
     AVNFRTEDDE LIGAEQCSAA DDVLLISRKG QAIRFSAGDD QLRPMGRATS GVTGMKFRGD       720
     DELLSMSIIH SDMPEDDRFV FTATGGGYAK RTAVSEYRQQ GRGGVGIKAM ALSEERGSLV       780
     GGLVVSEADE IIAIKTSGQI TRSAVSEVPA KGRSTMGVKF VSVRGGDAVS IIAVNPEHTV       840
     EEEVADESVE TVEGDATQAQ SGEVVRRSDT VDGDRAVDTA GNDMKPEDNG E                891
//

If you have problems or comments...

PBIL Back to PBIL home page