(data stored in ACNUC30630 zone)

EMBL: CP001977.HEML

CP001977.HEML        Location/Qualifiers
FT   CDS             complement(372761..374071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="HMPREF0675_3344"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00713"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3344"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99526"
FT                   /db_xref="GOA:D4HAK4"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAK4"
FT                   /protein_id="ADD99526.1"
FT                   /translation="MTSNAELFSAAQAVIPGGVDSPVRAYGSVGGVPRFIEKAQGPWIW
FT                   DAEGTRYVDLVCTWGPALLGHARPEVVSAVQVAASKGLSFGAPTRTETELADAIIERMA
FT                   PVEKVRFVSTGTEATMTAVRLARGTTGRDVIVKFAGNYHGHSDVLLAAAGSGVATAGLP
FT                   GSAGVPAASTADTIVVDYNDVAALDAMFSERGDQIAAVIVESCPANMGVVPPEPGFNAA
FT                   IRRLTTEHGALMITDEVLTGFRCSPSGFWGLQQQAGEDFAPDIFTFGKVIGGGMPLAAL
FT                   GGRAEVMDLLAPTGPVYQAGTLSGNPLATVAGVKTLQLADAGVYQRLDARSEKWRSELV
FT                   SALDAAGVTYRLQNAGNLFSVFLGVDSPVRNYDNAKSQNAEAYTAFFHAMLDAGVNLPP
FT                   SCFEAWFLSDAHDDEAFEVFRAALPKAAQAASQVISA"
     MTSNAELFSA AQAVIPGGVD SPVRAYGSVG GVPRFIEKAQ GPWIWDAEGT RYVDLVCTWG        60
     PALLGHARPE VVSAVQVAAS KGLSFGAPTR TETELADAII ERMAPVEKVR FVSTGTEATM       120
     TAVRLARGTT GRDVIVKFAG NYHGHSDVLL AAAGSGVATA GLPGSAGVPA ASTADTIVVD       180
     YNDVAALDAM FSERGDQIAA VIVESCPANM GVVPPEPGFN AAIRRLTTEH GALMITDEVL       240
     TGFRCSPSGF WGLQQQAGED FAPDIFTFGK VIGGGMPLAA LGGRAEVMDL LAPTGPVYQA       300
     GTLSGNPLAT VAGVKTLQLA DAGVYQRLDA RSEKWRSELV SALDAAGVTY RLQNAGNLFS       360
     VFLGVDSPVR NYDNAKSQNA EAYTAFFHAM LDAGVNLPPS CFEAWFLSDA HDDEAFEVFR       420
     AALPKAAQAA SQVISA                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page