(data stored in ACNUC30630 zone)

EMBL: CP001977.MANA

CP001977.MANA        Location/Qualifiers
FT   CDS             8300..9487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manA"
FT                   /locus_tag="HMPREF0675_3007"
FT                   /product="mannose-6-phosphate isomerase, class I"
FT                   /EC_number="5.3.1.8"
FT                   /note="identified by match to protein family HMM PF01238;
FT                   match to protein family HMM TIGR00218"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3007"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98937"
FT                   /db_xref="GOA:D4HEG6"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEG6"
FT                   /protein_id="ADD98937.1"
FT                   /translation="MRALTGQVQHYDWGSADAIPAILGTRPDGTPWAEYWLGAHPKAPS
FT                   ALPDGTPLDQWLTHHPDELGAGSREAFGDRLPFLLKILSANHALSIQAHPSREQAEKGF
FT                   AAENEAGVPLDAPNRIFRDDWPKPEMIVALTDFDALCGFRDPSSSLVLLSGLGEVDGLN
FT                   EVLTPLSQNDGLATLVAAVLSGDDDVTPVVKRVVSASRAYLNDGADEDVRSLATTAVEL
FT                   WEDHPGDPSILVALLMNRVRLAPGQQIHLCAGSMHAYLGGTGVEIMANSDNVLRGGLTS
FT                   KYIDVKALLDHANMTPEPCVGEYAQQISPGVGVYHTTFPEFRLWGLEGHNDVLDLPATE
FT                   LGRILLVTEGQLVAHCGTDDCELSRGQSVWLPAGDEVKVTGQGRGFLASAGVGDS"
     MRALTGQVQH YDWGSADAIP AILGTRPDGT PWAEYWLGAH PKAPSALPDG TPLDQWLTHH        60
     PDELGAGSRE AFGDRLPFLL KILSANHALS IQAHPSREQA EKGFAAENEA GVPLDAPNRI       120
     FRDDWPKPEM IVALTDFDAL CGFRDPSSSL VLLSGLGEVD GLNEVLTPLS QNDGLATLVA       180
     AVLSGDDDVT PVVKRVVSAS RAYLNDGADE DVRSLATTAV ELWEDHPGDP SILVALLMNR       240
     VRLAPGQQIH LCAGSMHAYL GGTGVEIMAN SDNVLRGGLT SKYIDVKALL DHANMTPEPC       300
     VGEYAQQISP GVGVYHTTFP EFRLWGLEGH NDVLDLPATE LGRILLVTEG QLVAHCGTDD       360
     CELSRGQSVW LPAGDEVKVT GQGRGFLASA GVGDS                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page