(data stored in ACNUC30630 zone)

EMBL: CP001977.MFD

CP001977.MFD         Location/Qualifiers
FT   CDS             611446..615114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="HMPREF0675_3593"
FT                   /product="transcription-repair coupling factor"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF02559; match to protein family HMM PF03461;
FT                   match to protein family HMM TIGR00580"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3593"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00037"
FT                   /db_xref="GOA:D4HC57"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC57"
FT                   /protein_id="ADE00037.1"
FT                   /translation="MLWGGESSRTTSRVMVSVGTTTYPMLVTFGGLTSLLSREPVLSHV
FT                   VEDALTRRTPTLDLQVAASARPAVAAVLGRSLDGSGRLPVLLVTSTFREAEESVATLKT
FT                   WLGADAVCYYPSWETLPHERLSPRTDTVGRRMEVLRRLCGTEGEVPQVVVAPVRSLLQP
FT                   QVAGLGRVAPVRLAVGEEHDLTELATELVNAAYSRVDMVERRGEFAVRGGIVDVFPPVL
FT                   EHPVRIDFFGDEIEEMTSFAVADQRSTDETHQELICAPCRELILTDEVRSRAKALLTDH
FT                   PELADMLERIGNGQAVEGMEALMPALVDEMELLVDVLPEHAMVVLSDPEMVRSRAADLV
FT                   RTSEEFLGAGWAAAAGGGQAPIDLAASGYRSLAQVRSHCLERGMAWWSMSSFSLDSSAT
FT                   DVLVDDDITSAPQTVNPQLVAVEPWHGDVEAAVKDLTARLDDGWTVLLCAEGEGMAKRM
FT                   SELLGEHNVAARLVDDVDPDATEPCVQVIRLHQRHGFAAESVKLLVASTGDLAESQDPG
FT                   GTGERRMPRRRRNQIQPLELKPGDLIVHEQHGVGRYVEMVQRTVGGATREYLVIEYAPS
FT                   KKGQPGDRLFVPVNSLDQVTRYVGGDAPSLDRMGGGDWRKRKARARKAVREIAAELIKL
FT                   YAARQATKGHAFGPDTAWQRELEGAFAYVETPDQLTTFADVKRDMEQVVPMDRLVCGDV
FT                   GYGKTEIAVRAAFKAVQDGKQVAVLVPTTLLVQQHFQTFTERYAGFPVKVAALSRFQTD
FT                   TEARETLEGLQRGTVDVVVGTHRLLAKEVEFKDLGLVIVDEEQRFGVEHKEALKRMRVN
FT                   VDVLAMSATPIPRTLEMAVTGIREMSTIATPPEERHPVLTFAGPYDEGQVVAAIRRELA
FT                   REGQVFYIHNRVQSIEKTAAKLRELVPEARIVTAHGQMNEKQLEQIMVDFWERRADVLV
FT                   CTTIVESGIDISTANTLLIDRADLMGLSQLHQLRGRVGRSRERGYAYFLYPADKPLSQT
FT                   AHDRLATMAAHTDLGSGMAIAMKDLEIRGAGNLLGGEQSGHIADVGFDLYIRLVGDAVA
FT                   EFRGDSTTADEPEMRIELPVDANLPVEYVETERLRLEMYKRLAEVRSDEEVDAIGAELV
FT                   DRYGPMPEPVQALLGVARFRLLCRQAGIHEVVPAGRNIRFSPVNLPESRVMRLKRLYPG
FT                   SVVKQTAGLVLVPKPMTATIGGQPLGGADLLKWSADLVTNVLAVDTPIGAGRPTEP"
     MLWGGESSRT TSRVMVSVGT TTYPMLVTFG GLTSLLSREP VLSHVVEDAL TRRTPTLDLQ        60
     VAASARPAVA AVLGRSLDGS GRLPVLLVTS TFREAEESVA TLKTWLGADA VCYYPSWETL       120
     PHERLSPRTD TVGRRMEVLR RLCGTEGEVP QVVVAPVRSL LQPQVAGLGR VAPVRLAVGE       180
     EHDLTELATE LVNAAYSRVD MVERRGEFAV RGGIVDVFPP VLEHPVRIDF FGDEIEEMTS       240
     FAVADQRSTD ETHQELICAP CRELILTDEV RSRAKALLTD HPELADMLER IGNGQAVEGM       300
     EALMPALVDE MELLVDVLPE HAMVVLSDPE MVRSRAADLV RTSEEFLGAG WAAAAGGGQA       360
     PIDLAASGYR SLAQVRSHCL ERGMAWWSMS SFSLDSSATD VLVDDDITSA PQTVNPQLVA       420
     VEPWHGDVEA AVKDLTARLD DGWTVLLCAE GEGMAKRMSE LLGEHNVAAR LVDDVDPDAT       480
     EPCVQVIRLH QRHGFAAESV KLLVASTGDL AESQDPGGTG ERRMPRRRRN QIQPLELKPG       540
     DLIVHEQHGV GRYVEMVQRT VGGATREYLV IEYAPSKKGQ PGDRLFVPVN SLDQVTRYVG       600
     GDAPSLDRMG GGDWRKRKAR ARKAVREIAA ELIKLYAARQ ATKGHAFGPD TAWQRELEGA       660
     FAYVETPDQL TTFADVKRDM EQVVPMDRLV CGDVGYGKTE IAVRAAFKAV QDGKQVAVLV       720
     PTTLLVQQHF QTFTERYAGF PVKVAALSRF QTDTEARETL EGLQRGTVDV VVGTHRLLAK       780
     EVEFKDLGLV IVDEEQRFGV EHKEALKRMR VNVDVLAMSA TPIPRTLEMA VTGIREMSTI       840
     ATPPEERHPV LTFAGPYDEG QVVAAIRREL AREGQVFYIH NRVQSIEKTA AKLRELVPEA       900
     RIVTAHGQMN EKQLEQIMVD FWERRADVLV CTTIVESGID ISTANTLLID RADLMGLSQL       960
     HQLRGRVGRS RERGYAYFLY PADKPLSQTA HDRLATMAAH TDLGSGMAIA MKDLEIRGAG      1020
     NLLGGEQSGH IADVGFDLYI RLVGDAVAEF RGDSTTADEP EMRIELPVDA NLPVEYVETE      1080
     RLRLEMYKRL AEVRSDEEVD AIGAELVDRY GPMPEPVQAL LGVARFRLLC RQAGIHEVVP      1140
     AGRNIRFSPV NLPESRVMRL KRLYPGSVVK QTAGLVLVPK PMTATIGGQP LGGADLLKWS      1200
     ADLVTNVLAV DTPIGAGRPT EP                                               1222
//

If you have problems or comments...

PBIL Back to PBIL home page