(data stored in ACNUC30630 zone)

EMBL: CP001977.MSRA

CP001977.MSRA        Location/Qualifiers
FT   CDS             complement(633719..634351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="HMPREF0675_3615"
FT                   /product="peptide-methionine (S)-S-oxide reductase"
FT                   /note="identified by match to protein family HMM PF01625;
FT                   match to protein family HMM TIGR00401"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3615"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99360"
FT                   /db_xref="GOA:D4HC73"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC73"
FT                   /protein_id="ADD99360.1"
FT                   /translation="MNKTEMVSSENALPGGHTPVLAMPFFHRVTGDRLDRPFPSSETIY
FT                   LAMGCFWGAEKLFWNTNGVLQTAVGYMGGLTPNPTYREVYTGCTGHAETVRVTYDPTQV
FT                   STEAILTIFLENHDPTQGMRQGNDVGTQYRSAIWCTTTEQFMTATTVKGSYQANLLNAG
FT                   YGAITTAISMANGVEFYLAEAEHQQYLEDNPFGYCPVHATGVCLAGS"
     MNKTEMVSSE NALPGGHTPV LAMPFFHRVT GDRLDRPFPS SETIYLAMGC FWGAEKLFWN        60
     TNGVLQTAVG YMGGLTPNPT YREVYTGCTG HAETVRVTYD PTQVSTEAIL TIFLENHDPT       120
     QGMRQGNDVG TQYRSAIWCT TTEQFMTATT VKGSYQANLL NAGYGAITTA ISMANGVEFY       180
     LAEAEHQQYL EDNPFGYCPV HATGVCLAGS                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page