(data stored in ACNUC30630 zone)

EMBL: CP001977.NIFJ

CP001977.NIFJ        Location/Qualifiers
FT   CDS             complement(219708..223322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifJ"
FT                   /locus_tag="HMPREF0675_3202"
FT                   /product="pyruvate synthase"
FT                   /EC_number="1.2.7.1"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF01558; match to protein
FT                   family HMM PF01855; match to protein family HMM TIGR02176"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3202"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00611"
FT                   /db_xref="GOA:D4H916"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:D4H916"
FT                   /protein_id="ADE00611.1"
FT                   /translation="MANSSDSRVRTIADGNTAAASVAYRCNELCSIYPITPSSPMAETA
FT                   DEWSAAGRKNIWGDIPTVMEMQSEGGAAGAIHGALQGGALSTTFTASQGLLLMIPNMYK
FT                   IAGELTSTVFHVAARSLAAQGLSIFGDHQDVMACRQTGFAMLCSSTVQECHDLALISQA
FT                   ATMRSRVPFMHFFEGFRTSHELNVLEMLSDDDIRHFITDDLVHAHRERALSPAHPFIRG
FT                   TAQNPDTHFQAREAANKYYEKVPSIVQSLMDEFAQVVGRQYHLVEYHGDPEATEVIVCM
FT                   GSGARTIEHTIDHFNARGHKLGLVELHLFRPFPTAEVVKAIPETARTVAVLDRTKEPGS
FT                   NGEPLFLDVLAALSEAHSRGTRNSMPIVSGGRYGISSKEFTPGMVAGIVAELELESPRP
FT                   RFTIGIDDDVTGISLPWEPLDIEDPTTIRAVFYGMGSDGTVGANKNTIKILGSDPNTYA
FT                   QGYFVYDSKKSGSKTTSHLRFGPKPIEAPYLVSQAGFIGIHAWGILESMDVLTMAREGT
FT                   TVLLNSPYSADEVWDKLPDTMQRQVLDKHLDLWTIDALSVARKVGLRNRTNTILQTCFF
FT                   AISGVLPKDEAIAKIKDSIQKTYGKKSQKIVEMNHAAVDASLEHLHQVKVPDQMTANHS
FT                   LIPAVREDSPKFVKNVTARMIEGFGDLLPVSALPDDGTYPAGTTKYEQRTLSDVIATWE
FT                   PNACIQCGNCAFVCPHGVIRSKYYPQSQLEGAPESFQSAELNAAGLPESCYTLQVVPDQ
FT                   CTGCGLCVEACPAHPVGEPDRKAINLEEHLDKTVQRENVKFFETIPVNDRSRVDFATVR
FT                   GTQFLEPLFEFSGACSGCGETPYVKLITQLFGDRAEVANATGCSSIYGGNLPTTPWGKN
FT                   ASGRGPAWSNSLFEDNAEFGLGMRMAANVQTVLARRRLQEVSSQLDPEFVEDLLHAPQL
FT                   TEHDLQSQQHRVKELQAKLADMEQTPAVRDLMSVADHLLRRSVWIIGGDGWAYDIGSGG
FT                   VDHVLASGRDVNVLVLDTEVYSNTGGQASKSTPLGAVAKFASAGKPTAKKDMALQAIAY
FT                   GSVYVARVALGADPQQTLRAFREAEAYPGPSLIIAYSHCIAHGYDLRNGLDQQYKAVHC
FT                   GHWPLMRYNPVLADEGRNPFLLDSPKPDETWREYTKLELRYRMLQKAHPEEAERMLDLG
FT                   QRQVERRYAEYAEMASRTAEDFAVDARMSEFAASSNRA"
     MANSSDSRVR TIADGNTAAA SVAYRCNELC SIYPITPSSP MAETADEWSA AGRKNIWGDI        60
     PTVMEMQSEG GAAGAIHGAL QGGALSTTFT ASQGLLLMIP NMYKIAGELT STVFHVAARS       120
     LAAQGLSIFG DHQDVMACRQ TGFAMLCSST VQECHDLALI SQAATMRSRV PFMHFFEGFR       180
     TSHELNVLEM LSDDDIRHFI TDDLVHAHRE RALSPAHPFI RGTAQNPDTH FQAREAANKY       240
     YEKVPSIVQS LMDEFAQVVG RQYHLVEYHG DPEATEVIVC MGSGARTIEH TIDHFNARGH       300
     KLGLVELHLF RPFPTAEVVK AIPETARTVA VLDRTKEPGS NGEPLFLDVL AALSEAHSRG       360
     TRNSMPIVSG GRYGISSKEF TPGMVAGIVA ELELESPRPR FTIGIDDDVT GISLPWEPLD       420
     IEDPTTIRAV FYGMGSDGTV GANKNTIKIL GSDPNTYAQG YFVYDSKKSG SKTTSHLRFG       480
     PKPIEAPYLV SQAGFIGIHA WGILESMDVL TMAREGTTVL LNSPYSADEV WDKLPDTMQR       540
     QVLDKHLDLW TIDALSVARK VGLRNRTNTI LQTCFFAISG VLPKDEAIAK IKDSIQKTYG       600
     KKSQKIVEMN HAAVDASLEH LHQVKVPDQM TANHSLIPAV REDSPKFVKN VTARMIEGFG       660
     DLLPVSALPD DGTYPAGTTK YEQRTLSDVI ATWEPNACIQ CGNCAFVCPH GVIRSKYYPQ       720
     SQLEGAPESF QSAELNAAGL PESCYTLQVV PDQCTGCGLC VEACPAHPVG EPDRKAINLE       780
     EHLDKTVQRE NVKFFETIPV NDRSRVDFAT VRGTQFLEPL FEFSGACSGC GETPYVKLIT       840
     QLFGDRAEVA NATGCSSIYG GNLPTTPWGK NASGRGPAWS NSLFEDNAEF GLGMRMAANV       900
     QTVLARRRLQ EVSSQLDPEF VEDLLHAPQL TEHDLQSQQH RVKELQAKLA DMEQTPAVRD       960
     LMSVADHLLR RSVWIIGGDG WAYDIGSGGV DHVLASGRDV NVLVLDTEVY SNTGGQASKS      1020
     TPLGAVAKFA SAGKPTAKKD MALQAIAYGS VYVARVALGA DPQQTLRAFR EAEAYPGPSL      1080
     IIAYSHCIAH GYDLRNGLDQ QYKAVHCGHW PLMRYNPVLA DEGRNPFLLD SPKPDETWRE      1140
     YTKLELRYRM LQKAHPEEAE RMLDLGQRQV ERRYAEYAEM ASRTAEDFAV DARMSEFAAS      1200
     SNRA                                                                   1204
//

If you have problems or comments...

PBIL Back to PBIL home page