(data stored in ACNUC30630 zone)

EMBL: CP001977.PE103

CP001977.PE103       Location/Qualifiers
FT   CDS             complement(118177..120141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3104"
FT                   /product="cobaltochelatase subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="identified by match to protein family HMM PF00092;
FT                   match to protein family HMM PF01078; match to protein
FT                   family HMM PF07728; match to protein family HMM TIGR02442"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3104"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00191"
FT                   /db_xref="GOA:D4HF43"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="InterPro:IPR041702"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF43"
FT                   /protein_id="ADE00191.1"
FT                   /translation="MTYPFTAVVGQDEARLALLLCAVNPRIGGVILSGEKGTAKSTVVR
FT                   GLVELLPGHIMRTLALGTTEDRLVGGLDLEATLVAGRPVLQPGLLSEVDGGVLYIDEVN
FT                   LLDDHLVDLVIDACAGTVRVEREGLTASLPSRFVLVGTMNPEEGALRPQLLDRFGLCID
FT                   VHGESDPAVRAEIIRRRLDHDADPAEFDHRWQSDQNRQAAVIERARHIVAGVRLDEVVT
FT                   ELISCLCRQNHVAGHRADIVMAEATRAHAALVGRGVATEDDVLTISEMVLRHRRRVETP
FT                   SESPPPRNQYPDDQPDQPEQRPREPERPDPDVEKRQAGENLATPPSSSGEQQPEYHDGP
FT                   QNQRDDGQHDPRKQPSGSGEQVVAAGDPFAVRPLEPGQDRFARRACGRRLRTRSNDRRG
FT                   HYVSARPTDRPDDLALDATLRAAAVHQKSRRATERPDLAVHVKPIDWRAKVRAGRAASC
FT                   VIFVVDASGSMGSRGRMTASKGAVLSLLLDAYVKRDRVCLIGFRRDRAEVLVPVTSSVE
FT                   VAQHGLAELPVGGRTPLSAGLIKACEVVRPLLLKDPGLRPLLILVTDGRGNVSLDGRPN
FT                   SQATDEAIRVATKLGVDTRLSWVVIDTEDPRGIQLSRARDIATALGGPCLRIDDLRADD
FT                   LVNVVSRLDPSHQSPRKDR"
     MTYPFTAVVG QDEARLALLL CAVNPRIGGV ILSGEKGTAK STVVRGLVEL LPGHIMRTLA        60
     LGTTEDRLVG GLDLEATLVA GRPVLQPGLL SEVDGGVLYI DEVNLLDDHL VDLVIDACAG       120
     TVRVEREGLT ASLPSRFVLV GTMNPEEGAL RPQLLDRFGL CIDVHGESDP AVRAEIIRRR       180
     LDHDADPAEF DHRWQSDQNR QAAVIERARH IVAGVRLDEV VTELISCLCR QNHVAGHRAD       240
     IVMAEATRAH AALVGRGVAT EDDVLTISEM VLRHRRRVET PSESPPPRNQ YPDDQPDQPE       300
     QRPREPERPD PDVEKRQAGE NLATPPSSSG EQQPEYHDGP QNQRDDGQHD PRKQPSGSGE       360
     QVVAAGDPFA VRPLEPGQDR FARRACGRRL RTRSNDRRGH YVSARPTDRP DDLALDATLR       420
     AAAVHQKSRR ATERPDLAVH VKPIDWRAKV RAGRAASCVI FVVDASGSMG SRGRMTASKG       480
     AVLSLLLDAY VKRDRVCLIG FRRDRAEVLV PVTSSVEVAQ HGLAELPVGG RTPLSAGLIK       540
     ACEVVRPLLL KDPGLRPLLI LVTDGRGNVS LDGRPNSQAT DEAIRVATKL GVDTRLSWVV       600
     IDTEDPRGIQ LSRARDIATA LGGPCLRIDD LRADDLVNVV SRLDPSHQSP RKDR             654
//

If you have problems or comments...

PBIL Back to PBIL home page