(data stored in ACNUC30630 zone)

EMBL: CP001977.PE106

CP001977.PE106       Location/Qualifiers
FT   CDS             complement(125134..126135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3107"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3107"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01129"
FT                   /db_xref="GOA:D4HF46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF46"
FT                   /protein_id="ADE01129.1"
FT                   /translation="MTGLTLSNLTVGYRSGRHVTRVLSGVTGSVAAGQMIGLVGPNGAG
FT                   KSTLLRSVAGLQPSLAGEVRINGTPTSRMSRRQVAQALSTVLTDRVSVARLTCRDVVSL
FT                   GRHPHSGIGGRLRPHDHAVIDESLTAVGAADLADAFIGELSDGQRQRVMVARALAQEPS
FT                   ILLLDEPTSFLDPPGRIALLGMLREVCTARNIAVVVCSHDIEPVMRYADTLWVAGHDTD
FT                   VVIGAPEDLARNGALEAAFRTEGITFDLRTLTFWQSDSGRPVARVVGHGVDADLARHVL
FT                   TRSGYRVVEQPGDEVLTIGVTDEGWAVDDCVLPTLSQLHEHLIGRHRERARS"
     MTGLTLSNLT VGYRSGRHVT RVLSGVTGSV AAGQMIGLVG PNGAGKSTLL RSVAGLQPSL        60
     AGEVRINGTP TSRMSRRQVA QALSTVLTDR VSVARLTCRD VVSLGRHPHS GIGGRLRPHD       120
     HAVIDESLTA VGAADLADAF IGELSDGQRQ RVMVARALAQ EPSILLLDEP TSFLDPPGRI       180
     ALLGMLREVC TARNIAVVVC SHDIEPVMRY ADTLWVAGHD TDVVIGAPED LARNGALEAA       240
     FRTEGITFDL RTLTFWQSDS GRPVARVVGH GVDADLARHV LTRSGYRVVE QPGDEVLTIG       300
     VTDEGWAVDD CVLPTLSQLH EHLIGRHRER ARS                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page