(data stored in ACNUC30630 zone)

EMBL: CP001977.PE115

CP001977.PE115       Location/Qualifiers
FT   CDS             complement(135855..136820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3117"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00637"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF55"
FT                   /protein_id="ADE00637.1"
FT                   /translation="MDMRENFELELRSNGGVARIVRDSPLRGQADRSVARGDTVRILPG
FT                   VVAATGAARHVTTMIQALKLWHRDATLVGMAALVLLGLKNPVTQRCWDYTGIQAIEAFS
FT                   PTRRLRRPRIWVHRWHVPHYFTIEDEGIRVAIPEVSVIILAIQGQWDWMCQALRQRLVT
FT                   PASCRAARKALTGRYSKAEVDRALADIDLNPWSIPELELARILRATGITGHKPNHQVWV
FT                   GEGNYRYVLDQAFQAEMLGVEMEGRSVHGTPEGYEAMMVRSAHLEQARWRILHTTPTML
FT                   RRDPKFVLDWIINHLHKRHRPKTTLTNQVLRQIMNGAVPA"
     MDMRENFELE LRSNGGVARI VRDSPLRGQA DRSVARGDTV RILPGVVAAT GAARHVTTMI        60
     QALKLWHRDA TLVGMAALVL LGLKNPVTQR CWDYTGIQAI EAFSPTRRLR RPRIWVHRWH       120
     VPHYFTIEDE GIRVAIPEVS VIILAIQGQW DWMCQALRQR LVTPASCRAA RKALTGRYSK       180
     AEVDRALADI DLNPWSIPEL ELARILRATG ITGHKPNHQV WVGEGNYRYV LDQAFQAEML       240
     GVEMEGRSVH GTPEGYEAMM VRSAHLEQAR WRILHTTPTM LRRDPKFVLD WIINHLHKRH       300
     RPKTTLTNQV LRQIMNGAVP A                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page