(data stored in ACNUC30630 zone)

EMBL: CP001977.PE122

CP001977.PE122       Location/Qualifiers
FT   CDS             144395..145078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3124"
FT                   /product="response regulator receiver domain protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3124"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99635"
FT                   /db_xref="GOA:D4HF62"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF62"
FT                   /protein_id="ADD99635.1"
FT                   /translation="MRILIADDDPQFLRALRITLGARGYEVLLARDGQHALEMAIDHKP
FT                   DIILLDLGMPRLDGVKVIEAVRGWSSAPILVISGRSGSAEKVEALDAGADDYVTKPFSM
FT                   DELLARIRVLTRRIGQDEVDEEPIVAFGSVWVDLAAHTVTRDGANVRLTPTEWRVLELL
FT                   IRNEGRLVTRQTMLSQVWGSEHVTDTGYLRLYISQLRKKLEPEPSRPRYLITDAGMGYR
FT                   LVLDP"
     MRILIADDDP QFLRALRITL GARGYEVLLA RDGQHALEMA IDHKPDIILL DLGMPRLDGV        60
     KVIEAVRGWS SAPILVISGR SGSAEKVEAL DAGADDYVTK PFSMDELLAR IRVLTRRIGQ       120
     DEVDEEPIVA FGSVWVDLAA HTVTRDGANV RLTPTEWRVL ELLIRNEGRL VTRQTMLSQV       180
     WGSEHVTDTG YLRLYISQLR KKLEPEPSRP RYLITDAGMG YRLVLDP                     227
//

If you have problems or comments...

PBIL Back to PBIL home page