(data stored in ACNUC30630 zone)

EMBL: CP001977.PE125

CP001977.PE125       Location/Qualifiers
FT   CDS             146352..148049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3127"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3127"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99616"
FT                   /db_xref="GOA:D4HF65"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF65"
FT                   /protein_id="ADD99616.1"
FT                   /translation="MSAIEVINLSFSFSAQPLLDNVSFSVGDSERAVLVGPNGSGKTTL
FT                   LRLIRGELTPDRGHIAISDAGDAGSCRFPYVRDATGTVQDYLDDVLAGPWELLTRFDHV
FT                   TKQLSAAQSSASLAKEYDHILTSLTLADVWSLEARIDEVLAGLGLGQLTGRGRQRALGS
FT                   LSPGQAVRLELAGIIMVRPVTLVLDEPTNHLDDEAVGFLIQQITDWPGPVLMASHNRAF
FT                   IEETATVIYDLDIAPWQALATAEGEAVSGVYRCTGAYSDYLGAKQHARMEHQKLHATQQ
FT                   SEKRAIRSHRRRSEDIARGGVKLAKAQGMARKFFSDRAEKTALRRTRNDDQRLHDLAEH
FT                   EVRKPRNYQLKLNLPPVGSRGGLAVTARSAFIPGRLLPITFDLATGEHLILTGPNGAGK
FT                   TTLLNWLASGKTTIDPRSEASGTISVSGRLAYVPQRLPRTGDSYFHPEHWKDGIRELGT
FT                   GILHPSMWATPVGQLSDGNQRRAQIALAVAQKPEILVIDEPTNYLDLATLEELEDALRQ
FT                   WNGTLIIASHDRWLINHWQGTQIELCPTDPAPGSPNPLLLVKSRFEPW"
     MSAIEVINLS FSFSAQPLLD NVSFSVGDSE RAVLVGPNGS GKTTLLRLIR GELTPDRGHI        60
     AISDAGDAGS CRFPYVRDAT GTVQDYLDDV LAGPWELLTR FDHVTKQLSA AQSSASLAKE       120
     YDHILTSLTL ADVWSLEARI DEVLAGLGLG QLTGRGRQRA LGSLSPGQAV RLELAGIIMV       180
     RPVTLVLDEP TNHLDDEAVG FLIQQITDWP GPVLMASHNR AFIEETATVI YDLDIAPWQA       240
     LATAEGEAVS GVYRCTGAYS DYLGAKQHAR MEHQKLHATQ QSEKRAIRSH RRRSEDIARG       300
     GVKLAKAQGM ARKFFSDRAE KTALRRTRND DQRLHDLAEH EVRKPRNYQL KLNLPPVGSR       360
     GGLAVTARSA FIPGRLLPIT FDLATGEHLI LTGPNGAGKT TLLNWLASGK TTIDPRSEAS       420
     GTISVSGRLA YVPQRLPRTG DSYFHPEHWK DGIRELGTGI LHPSMWATPV GQLSDGNQRR       480
     AQIALAVAQK PEILVIDEPT NYLDLATLEE LEDALRQWNG TLIIASHDRW LINHWQGTQI       540
     ELCPTDPAPG SPNPLLLVKS RFEPW                                             565
//

If you have problems or comments...

PBIL Back to PBIL home page