(data stored in ACNUC30630 zone)

EMBL: CP001977.PE128

CP001977.PE128       Location/Qualifiers
FT   CDS             complement(149611..150813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3130"
FT                   /product="resolvase, N-terminal domain protein"
FT                   /note="identified by match to protein family HMM PF00239;
FT                   match to protein family HMM PF07508; overlaps another CDS
FT                   with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3130"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99241"
FT                   /db_xref="GOA:D4HF68"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF68"
FT                   /protein_id="ADD99241.1"
FT                   /translation="MTSRSFRVIPPRPATPRRLRVAGYARVSTEHERQLSSIAAQVSYY
FT                   SHLIQSTPGWDYAGVFIDEGITGTSTVRREGFQTMMAAARSGDIDMILTKSISRLTRNT
FT                   VDLLDAVRELKILGVSVRFEREQIDTATADGELLLTLLASFAQEESRSMSKNVKWGIRK
FT                   KYADGLMHSRQPYGYQYVGSDLAIIETEAKIISQLNAEGVKPRRGAKFRGKTIRKWLEN
FT                   EIYTGRVILQKYYRPNVAELNCHTNTGELPRYLVDESHPPIIDQTTFGAVQAELARRRH
FT                   LGRGATPSARTTGLTSRIECSVCSRFYHRRTKTRRHTSYKFWWCETATKGKGNPCQAPQ
FT                   IRETHLTQICTRVLGLDDWDDEYALTRLVKIVVNPDRTLTIHTISGEVPVAVSLDEESA
FT                   I"
     MTSRSFRVIP PRPATPRRLR VAGYARVSTE HERQLSSIAA QVSYYSHLIQ STPGWDYAGV        60
     FIDEGITGTS TVRREGFQTM MAAARSGDID MILTKSISRL TRNTVDLLDA VRELKILGVS       120
     VRFEREQIDT ATADGELLLT LLASFAQEES RSMSKNVKWG IRKKYADGLM HSRQPYGYQY       180
     VGSDLAIIET EAKIISQLNA EGVKPRRGAK FRGKTIRKWL ENEIYTGRVI LQKYYRPNVA       240
     ELNCHTNTGE LPRYLVDESH PPIIDQTTFG AVQAELARRR HLGRGATPSA RTTGLTSRIE       300
     CSVCSRFYHR RTKTRRHTSY KFWWCETATK GKGNPCQAPQ IRETHLTQIC TRVLGLDDWD       360
     DEYALTRLVK IVVNPDRTLT IHTISGEVPV AVSLDEESAI                             400
//

If you have problems or comments...

PBIL Back to PBIL home page