(data stored in ACNUC30630 zone)

EMBL: CP001977.PE129

CP001977.PE129       Location/Qualifiers
FT   CDS             complement(150870..151058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3131"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3131"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98911"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF69"
FT                   /protein_id="ADD98911.1"
FT                   /translation="MTGAMFNAEVDLARQVAFIDRLTETGALTPNESHVILTRIGHEAT
FT                   APVGALLLQVRLDKTQV"
     MTGAMFNAEV DLARQVAFID RLTETGALTP NESHVILTRI GHEATAPVGA LLLQVRLDKT        60
     QV                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page