(data stored in ACNUC30630 zone)

EMBL: CP001977.PE13

CP001977.PE13        Location/Qualifiers
FT   CDS             16721..17872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3012"
FT                   /product="sugar-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3012"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99349"
FT                   /db_xref="GOA:D4HEH1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEH1"
FT                   /protein_id="ADD99349.1"
FT                   /translation="MTHKPTIKDVARLAGVSLGTASRVLNGSSATSEASRSAVHNAAHE
FT                   LGYLSNAHARSLRSSHSGVIGLVVPDIRNPYFAELASVVENACLAHGWATLLCNADESP
FT                   DQFNRYVNTLRRQRVDGAIVTPTGSGGQAVKDLVDDGVQVVCVDREITGSPLPAVTSDP
FT                   WNGMRQAVHHLVDHGHRRIGFITGPQQTSTGLERYQAYRQLLAEHGLEVDEDLVVEGDF
FT                   QEESGRMGARRLLDGGATAIFASDSLMSMGALRTCIDQGVRIGDEIDLVGFDDLPVFSL
FT                   TNPALTVVAQDIDVMGKVAVDLLNRAMSGEPTSSARLDTHLIVRASTRMVKENQWQQYF
FT                   DSTTSLRLSDPSRSSKTYRWTSFLAGCASCSVKTEPESPPSSR"
     MTHKPTIKDV ARLAGVSLGT ASRVLNGSSA TSEASRSAVH NAAHELGYLS NAHARSLRSS        60
     HSGVIGLVVP DIRNPYFAEL ASVVENACLA HGWATLLCNA DESPDQFNRY VNTLRRQRVD       120
     GAIVTPTGSG GQAVKDLVDD GVQVVCVDRE ITGSPLPAVT SDPWNGMRQA VHHLVDHGHR       180
     RIGFITGPQQ TSTGLERYQA YRQLLAEHGL EVDEDLVVEG DFQEESGRMG ARRLLDGGAT       240
     AIFASDSLMS MGALRTCIDQ GVRIGDEIDL VGFDDLPVFS LTNPALTVVA QDIDVMGKVA       300
     VDLLNRAMSG EPTSSARLDT HLIVRASTRM VKENQWQQYF DSTTSLRLSD PSRSSKTYRW       360
     TSFLAGCASC SVKTEPESPP SSR                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page