(data stored in ACNUC30630 zone)

EMBL: CP001977.PE134

CP001977.PE134       Location/Qualifiers
FT   CDS             155183..155302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3137"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3137"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00835"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF74"
FT                   /protein_id="ADE00835.1"
FT                   /translation="MSVGVVTLTSPTLIATRGSKHVRRILRERTVEHWCCEVV"
     MSVGVVTLTS PTLIATRGSK HVRRILRERT VEHWCCEVV                               39
//

If you have problems or comments...

PBIL Back to PBIL home page