(data stored in ACNUC30630 zone)

EMBL: CP001977.PE138

CP001977.PE138       Location/Qualifiers
FT   CDS             159636..160811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3141"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01256"
FT                   /db_xref="GOA:D4HF78"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF78"
FT                   /protein_id="ADE01256.1"
FT                   /translation="MTRTGRATARRFAPTADGRLVAQTWLGSRAILLVVAVVVMTGYHR
FT                   TFSQVTGNWDVQHYMSIARNGYADPLEMAFFPGLPALLKGGSFLGTPMEVTGVLLGLIG
FT                   SALAAWALFRIGGMLPACLWLIAPATVFTMVGYTEAPFCAAAFWAWERARAGRWWAAAL
FT                   LAGLACTFRVSGLFLIGALAVLAVLGDRDEGRPTSQAARRRRLIDVVNRLSTLLVPTAV
FT                   LVAFVVWLHRLTGSWTAWSQAQTNGWRRGFTTPAETLRHTLPATHADTWRSLYGAGASG
FT                   VAVVFRLELVSVALGVLVFVYCLVRQRWASASWVGIQVVAFSIGYWYMSVNRATLLWFP
FT                   LFVALAEVTRGPSKPPGLVLLWRGIMGIVIAIDLAVMVWWGWRFFTGGWAS"
     MTRTGRATAR RFAPTADGRL VAQTWLGSRA ILLVVAVVVM TGYHRTFSQV TGNWDVQHYM        60
     SIARNGYADP LEMAFFPGLP ALLKGGSFLG TPMEVTGVLL GLIGSALAAW ALFRIGGMLP       120
     ACLWLIAPAT VFTMVGYTEA PFCAAAFWAW ERARAGRWWA AALLAGLACT FRVSGLFLIG       180
     ALAVLAVLGD RDEGRPTSQA ARRRRLIDVV NRLSTLLVPT AVLVAFVVWL HRLTGSWTAW       240
     SQAQTNGWRR GFTTPAETLR HTLPATHADT WRSLYGAGAS GVAVVFRLEL VSVALGVLVF       300
     VYCLVRQRWA SASWVGIQVV AFSIGYWYMS VNRATLLWFP LFVALAEVTR GPSKPPGLVL       360
     LWRGIMGIVI AIDLAVMVWW GWRFFTGGWA S                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page