(data stored in ACNUC30630 zone)

EMBL: CP001977.PE147

CP001977.PE147       Location/Qualifiers
FT   CDS             169913..171295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3150"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00180"
FT                   /db_xref="GOA:D4HF87"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF87"
FT                   /protein_id="ADE00180.1"
FT                   /translation="MTPIFRLHDSPDGSSAVTLLRSVAPIQWFSGAAEVIVACLFVTCT
FT                   FVTVAQPVFDNGACQLMLPLFAVAALVLEALCIVRDVRGVPSPREWSRSLTIVTCSFVA
FT                   LLVWAAVSIPFHEHLIYDDSMGVTRDLPLYALVMPLAEATVTLLVAIFACRMIAVGNLE
FT                   GALWRLSMLMAIANPIDLVREYVEGNTTGWRVATRLGGAAICHVLLILALAVAVDAVIR
FT                   HRHRILSSVAAVSHLGCLAASGSRAGTISLALFVIGLVFFGRSYRTRSRKQRTVIAMLG
FT                   LLTAGVAIWLVSTVRSGSLVDPARARTWALAGRVVVDSPSHFLVGTGYGTIWPWFAVES
FT                   TFMPESSHGMRQTLYGYSLPHAHSLIAQVVGELGVIGLALILVCLGTVIAVCVKGIRGG
FT                   YPLLSLGVLATMPAFLMDTYLIKNFPVALFWWIFTLALCRLVTTGDADVEGDSGYREEK
FT                   YA"
     MTPIFRLHDS PDGSSAVTLL RSVAPIQWFS GAAEVIVACL FVTCTFVTVA QPVFDNGACQ        60
     LMLPLFAVAA LVLEALCIVR DVRGVPSPRE WSRSLTIVTC SFVALLVWAA VSIPFHEHLI       120
     YDDSMGVTRD LPLYALVMPL AEATVTLLVA IFACRMIAVG NLEGALWRLS MLMAIANPID       180
     LVREYVEGNT TGWRVATRLG GAAICHVLLI LALAVAVDAV IRHRHRILSS VAAVSHLGCL       240
     AASGSRAGTI SLALFVIGLV FFGRSYRTRS RKQRTVIAML GLLTAGVAIW LVSTVRSGSL       300
     VDPARARTWA LAGRVVVDSP SHFLVGTGYG TIWPWFAVES TFMPESSHGM RQTLYGYSLP       360
     HAHSLIAQVV GELGVIGLAL ILVCLGTVIA VCVKGIRGGY PLLSLGVLAT MPAFLMDTYL       420
     IKNFPVALFW WIFTLALCRL VTTGDADVEG DSGYREEKYA                             460
//

If you have problems or comments...

PBIL Back to PBIL home page