(data stored in ACNUC30630 zone)

EMBL: CP001977.PE156

CP001977.PE156       Location/Qualifiers
FT   CDS             179904..181202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3159"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00984;
FT                   match to protein family HMM PF03721; match to protein
FT                   family HMM TIGR03026"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3159"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99858"
FT                   /db_xref="GOA:D4HF96"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF96"
FT                   /protein_id="ADD99858.1"
FT                   /translation="MKIAVVAMGKIGLPLAVQFAEKGHDVIGVDVQQRVVDEINKGNEP
FT                   FPGEAFLDEKLKKLVPAGKLTATTDYSQAIPGADAIVLVVPLFVNDETWEPDFGWMENA
FT                   TKSLAEHLTPGTLISYETTLPVGTTRNRWKPMIEEISGLSEGKDFHLVFSPERVLTGRV
FT                   FADLRRYPKLVGGLNDEGTAKGIDFYQQVLDFDDRDDLPRANGVWDMGTAEAAEMAKLA
FT                   ETTYRDVNIGLANQFGKYAAANGIDVYKVIDACNSQPYSHIHRPGIAVGGHCIPVYPRL
FT                   YLWTDPDATIVRTAREANMTMPQYCVDQAASVLGDLSGKKIVVLGASYRGKVKETAFSG
FT                   VFPTVDILAKAGADVSVHDPMFTDEELGKFGFKAYHIGDPVDGALLQADHPEYAELTPA
FT                   DLPGIKVLVDGRHVVDPAVWGDVEVIVVGDGEA"
     MKIAVVAMGK IGLPLAVQFA EKGHDVIGVD VQQRVVDEIN KGNEPFPGEA FLDEKLKKLV        60
     PAGKLTATTD YSQAIPGADA IVLVVPLFVN DETWEPDFGW MENATKSLAE HLTPGTLISY       120
     ETTLPVGTTR NRWKPMIEEI SGLSEGKDFH LVFSPERVLT GRVFADLRRY PKLVGGLNDE       180
     GTAKGIDFYQ QVLDFDDRDD LPRANGVWDM GTAEAAEMAK LAETTYRDVN IGLANQFGKY       240
     AAANGIDVYK VIDACNSQPY SHIHRPGIAV GGHCIPVYPR LYLWTDPDAT IVRTAREANM       300
     TMPQYCVDQA ASVLGDLSGK KIVVLGASYR GKVKETAFSG VFPTVDILAK AGADVSVHDP       360
     MFTDEELGKF GFKAYHIGDP VDGALLQADH PEYAELTPAD LPGIKVLVDG RHVVDPAVWG       420
     DVEVIVVGDG EA                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page