(data stored in ACNUC30630 zone)

EMBL: CP001977.PE169

CP001977.PE169       Location/Qualifiers
FT   CDS             194340..195134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3172"
FT                   /product="CobQ/CobB/MinD/ParA nucleotide binding domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3172"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00202"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4H8Y7"
FT                   /protein_id="ADE00202.1"
FT                   /translation="MTAQIFALCNQKGGVGKSTSTFHLARAAVLRGQRVLVVDNDPQGN
FT                   LTSVAAAEPVGEDQAGLADVLSARAPETLRDVIVPGIWSGLDVVPTSGITLGWVRDELV
FT                   IAGAGREGRLREALAGVEDDYDVILIDCAPSLDQLTINGLVAAQGVIVVTHSKLWSANG
FT                   LAQLLDTIDSVRSYYNGALRVAGIIVNQHEENTISGKTWLDELHQAAESRKLTVLDPPI
FT                   PKRVVIADTVEAARGLDEWGSAEAAALGQLYAHHLTCIEGAL"
     MTAQIFALCN QKGGVGKSTS TFHLARAAVL RGQRVLVVDN DPQGNLTSVA AAEPVGEDQA        60
     GLADVLSARA PETLRDVIVP GIWSGLDVVP TSGITLGWVR DELVIAGAGR EGRLREALAG       120
     VEDDYDVILI DCAPSLDQLT INGLVAAQGV IVVTHSKLWS ANGLAQLLDT IDSVRSYYNG       180
     ALRVAGIIVN QHEENTISGK TWLDELHQAA ESRKLTVLDP PIPKRVVIAD TVEAARGLDE       240
     WGSAEAAALG QLYAHHLTCI EGAL                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page