(data stored in ACNUC30630 zone)

EMBL: CP001977.PE188

CP001977.PE188       Location/Qualifiers
FT   CDS             complement(209281..210072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3191"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07512"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3191"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00024"
FT                   /db_xref="UniProtKB/TrEMBL:D4H906"
FT                   /protein_id="ADE00024.1"
FT                   /translation="MTAANDAPQVCEEGPGQNNGLGGIPIFRGIDLPEAYRHQSYHAPT
FT                   VSRETLQEWFSPARLSRYRIEPVDAWYVWNTRISKAFLEDISHVEVLLRNFIDVRLSAD
FT                   TGIRRWWESPSYRLGGFPRNVDRAEKRLRRARLDATPDQIVASLSLDNWRFLLTPRLEA
FT                   TVWKALTDLRNGGMPHYPGRSRRDFEENVELIRHVRNRASHQEPLISAHPDQQAEIRRL
FT                   AHYVTAIDTVARNINPDAAEWIATHSRVLDAIAQRPTPQDH"
     MTAANDAPQV CEEGPGQNNG LGGIPIFRGI DLPEAYRHQS YHAPTVSRET LQEWFSPARL        60
     SRYRIEPVDA WYVWNTRISK AFLEDISHVE VLLRNFIDVR LSADTGIRRW WESPSYRLGG       120
     FPRNVDRAEK RLRRARLDAT PDQIVASLSL DNWRFLLTPR LEATVWKALT DLRNGGMPHY       180
     PGRSRRDFEE NVELIRHVRN RASHQEPLIS AHPDQQAEIR RLAHYVTAID TVARNINPDA       240
     AEWIATHSRV LDAIAQRPTP QDH                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page