(data stored in ACNUC30630 zone)

EMBL: CP001977.PE190

CP001977.PE190       Location/Qualifiers
FT   CDS             complement(212198..212695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3193"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF09352"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3193"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99440"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:D4H908"
FT                   /protein_id="ADD99440.1"
FT                   /translation="MTRPWGHNGCDTRNDALARDLVEAHLKPGSRCVVVSGRLHDPYTG
FT                   STLAWRRGRHTSTTVQIDHVVALGNAWITGAQKLSPLQRTALANDPLNLLAVDGPANEA
FT                   KRDRDAATWLPPNKAYRCDYVARQIAVKTKYQLWVTPAEKTAMARVLHRCPAQTLPVGA
FT                   TR"
     MTRPWGHNGC DTRNDALARD LVEAHLKPGS RCVVVSGRLH DPYTGSTLAW RRGRHTSTTV        60
     QIDHVVALGN AWITGAQKLS PLQRTALAND PLNLLAVDGP ANEAKRDRDA ATWLPPNKAY       120
     RCDYVARQIA VKTKYQLWVT PAEKTAMARV LHRCPAQTLP VGATR                       165
//

If you have problems or comments...

PBIL Back to PBIL home page