(data stored in ACNUC30630 zone)

EMBL: CP001977.PE20

CP001977.PE20        Location/Qualifiers
FT   CDS             complement(23191..23667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3020"
FT                   /product="phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2"
FT                   /note="identified by match to protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3020"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99346"
FT                   /db_xref="GOA:D4HEH8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEH8"
FT                   /protein_id="ADD99346.1"
FT                   /translation="MSVLLNTDLISVNIEAPDRNQVLTVMADKLNGVRVAKEGFLDALL
FT                   KREETYPTGLPISGGVAIPHTDPQYVTRDALAVTTLHTPVLFGQMGGSEEDEVPVSVVI
FT                   LMALSNADDHLNMLQNIVKSIQDDNLMQTIRSATKPEEVVSIVRPMIPADTEDS"
     MSVLLNTDLI SVNIEAPDRN QVLTVMADKL NGVRVAKEGF LDALLKREET YPTGLPISGG        60
     VAIPHTDPQY VTRDALAVTT LHTPVLFGQM GGSEEDEVPV SVVILMALSN ADDHLNMLQN       120
     IVKSIQDDNL MQTIRSATKP EEVVSIVRPM IPADTEDS                               158
//

If you have problems or comments...

PBIL Back to PBIL home page