(data stored in ACNUC30630 zone)

EMBL: CP001977.PE204

CP001977.PE204       Location/Qualifiers
FT   CDS             229441..230976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3208"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF02589;
FT                   match to protein family HMM TIGR00273"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3208"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99288"
FT                   /db_xref="GOA:D4H922"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D4H922"
FT                   /protein_id="ADD99288.1"
FT                   /translation="MSTELRRVTYGNHGVARLTPAPDKPGTYMGMPKFSKAVKGELNLS
FT                   VQRKNMRNATMTIRNKRAMRVSESPDWQDLRDAAESIKNRVGRHLDHYLVEAEKNLTAN
FT                   GVHVHWARDGEEANRIVAQIAKDKGVDEVVKIKSITSQETDLNEYLEEQGIAAWETDLA
FT                   ELIVQLGHDRPSHIVVPAIHRNRAEVREIFLHEMKNYGRPAPEDISENPPELTNAARLH
FT                   LREKFLRAEMAVSGGNFVLADTGSLVIVESEGNGRMCLTLPDTLVSIVGIEKVLPSFDD
FT                   LEVFLKLLPRSATGERMNPYNSVWSGVTDGDGPQEQHVIFLDNGRTDVLADTLGREVLR
FT                   CIRCASCINICPVYERAGGHAYGSVYPGPIGAVLNPQLRGVEHPVDRGLPYACSLCGAC
FT                   NEVCPVKIPFTDILLKLRNKVVKSEKADRIPQDYEVAGEMGLMKTASWAFSDHKHFEAI
FT                   QVGSRGVGRVLRGKKMGPVPVPVAERWLKYRDVDAPPADTFRTWWKKNREAQR"
     MSTELRRVTY GNHGVARLTP APDKPGTYMG MPKFSKAVKG ELNLSVQRKN MRNATMTIRN        60
     KRAMRVSESP DWQDLRDAAE SIKNRVGRHL DHYLVEAEKN LTANGVHVHW ARDGEEANRI       120
     VAQIAKDKGV DEVVKIKSIT SQETDLNEYL EEQGIAAWET DLAELIVQLG HDRPSHIVVP       180
     AIHRNRAEVR EIFLHEMKNY GRPAPEDISE NPPELTNAAR LHLREKFLRA EMAVSGGNFV       240
     LADTGSLVIV ESEGNGRMCL TLPDTLVSIV GIEKVLPSFD DLEVFLKLLP RSATGERMNP       300
     YNSVWSGVTD GDGPQEQHVI FLDNGRTDVL ADTLGREVLR CIRCASCINI CPVYERAGGH       360
     AYGSVYPGPI GAVLNPQLRG VEHPVDRGLP YACSLCGACN EVCPVKIPFT DILLKLRNKV       420
     VKSEKADRIP QDYEVAGEMG LMKTASWAFS DHKHFEAIQV GSRGVGRVLR GKKMGPVPVP       480
     VAERWLKYRD VDAPPADTFR TWWKKNREAQ R                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page