(data stored in ACNUC30630 zone)

EMBL: CP001977.PE205

CP001977.PE205       Location/Qualifiers
FT   CDS             230973..231653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3209"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02589"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3209"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99788"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D4H923"
FT                   /protein_id="ADD99788.1"
FT                   /translation="MTTISTDPVARTEILARIRPASTDITNSDPVADVPIEWEYGTGID
FT                   MDDVVGTFVEKVIDYKATVVRVKGADVPQAVVEGLRSTGAEHSAVVPVGLDKSWVGAIK
FT                   TAGFDARLDDPQLSKKELNDTDAVVTGAACGIADTGSIVLTHVEDQGRRAITLVPDRHV
FT                   CVVKASQVVSDVPEAIQIVKPAVHEGHPLTFISGGSATSDIELSRVDGVHGPRRLYVIV
FT                   VDDR"
     MTTISTDPVA RTEILARIRP ASTDITNSDP VADVPIEWEY GTGIDMDDVV GTFVEKVIDY        60
     KATVVRVKGA DVPQAVVEGL RSTGAEHSAV VPVGLDKSWV GAIKTAGFDA RLDDPQLSKK       120
     ELNDTDAVVT GAACGIADTG SIVLTHVEDQ GRRAITLVPD RHVCVVKASQ VVSDVPEAIQ       180
     IVKPAVHEGH PLTFISGGSA TSDIELSRVD GVHGPRRLYV IVVDDR                      226
//

If you have problems or comments...

PBIL Back to PBIL home page