(data stored in ACNUC30630 zone)

EMBL: CP001977.PE212

CP001977.PE212       Location/Qualifiers
FT   CDS             complement(238679..240199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3216"
FT                   /product="bacterial cytochrome ubiquinol oxidase"
FT                   /note="identified by match to protein family HMM PF01654"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3216"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99740"
FT                   /db_xref="GOA:D4H930"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:D4H930"
FT                   /protein_id="ADD99740.1"
FT                   /translation="MDAQLIARWQFGITTVYHFFFVPITIALSMLVAVMQTVWLKTRND
FT                   RYLRLTKFYGKLFLINFALGVVTGIVQEFQFGMNWSEYSRFVGDIFGAPLALEALVAFF
FT                   MESTFVGLWVFGWEKLPKGVHLACIYLTAIGTMISAVFILAANSWMQNPVGASYNPVTH
FT                   RAELTDFGAVLSNPVFKATFVHQISSSYTVAGALIAAIAFWHLAKVARGRTTSQISDAE
FT                   EVESVRTWRWASKFGAWVLIVACVGVVLSGDYQGKVMTDAQPMKMAAAEAAYQNTSDFS
FT                   VLTIGNKDGSEEVWALKIPGMLGFLGNGKWGSQVKGINELKSYQVHEYTYHRKDGSQTP
FT                   LQASYQNVLRQKIDANGIKLEPNVPLSYWTFRIMITLGMIGGLIGLVMLIAMRGGRNPK
FT                   PHGWLTLFMIALPLLPLFAISFGWIFTEMGRQPWIVAGVLPTTAAVSPNVSAGSVLFST
FT                   IAYTVVYGILAVVEVGLFWKALKEGLPELSTRDQPVTEGEDTPLSFAY"
     MDAQLIARWQ FGITTVYHFF FVPITIALSM LVAVMQTVWL KTRNDRYLRL TKFYGKLFLI        60
     NFALGVVTGI VQEFQFGMNW SEYSRFVGDI FGAPLALEAL VAFFMESTFV GLWVFGWEKL       120
     PKGVHLACIY LTAIGTMISA VFILAANSWM QNPVGASYNP VTHRAELTDF GAVLSNPVFK       180
     ATFVHQISSS YTVAGALIAA IAFWHLAKVA RGRTTSQISD AEEVESVRTW RWASKFGAWV       240
     LIVACVGVVL SGDYQGKVMT DAQPMKMAAA EAAYQNTSDF SVLTIGNKDG SEEVWALKIP       300
     GMLGFLGNGK WGSQVKGINE LKSYQVHEYT YHRKDGSQTP LQASYQNVLR QKIDANGIKL       360
     EPNVPLSYWT FRIMITLGMI GGLIGLVMLI AMRGGRNPKP HGWLTLFMIA LPLLPLFAIS       420
     FGWIFTEMGR QPWIVAGVLP TTAAVSPNVS AGSVLFSTIA YTVVYGILAV VEVGLFWKAL       480
     KEGLPELSTR DQPVTEGEDT PLSFAY                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page