(data stored in ACNUC30630 zone)

EMBL: CP001977.PE213

CP001977.PE213       Location/Qualifiers
FT   CDS             complement(240334..241887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3217"
FT                   /product="Tat pathway signal sequence domain protein"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3217"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00403"
FT                   /db_xref="GOA:D4H931"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D4H931"
FT                   /protein_id="ADE00403.1"
FT                   /translation="MAEVKNSQLTAHNDTDMAKDQTKVLQRTLNRFDIVFLIVSAVVGL
FT                   EMLGSVSAEGPETFTWLVFLIIVFLIPYSLIFAETGSAFVGEGGVYLWTRRAFGRPAAA
FT                   VTSVFTWITQPVWVGGSMAFLNAEAARNHLVHFSAGSAGDYLFKLAFIWLTVFAAILSL
FT                   AKAKWIPTAGAFFKISFLCLFLVTAAVYATQHGVQPLSLGSFSPTLRGFITLTPLLLFA
FT                   FLGFEGGSSASGEMRNAQHDVSVSVLRSATMAGIFYLLPVATILLVLPPSDIDGVSGLL
FT                   KAVNTVFSVYGPAAEPMMVLALVMFTLANIGQGAAWMIMSDRMQAMAAADGSFFGGFFG
FT                   KFHPRLGTPVHVNLLSGIVSTLFMLAAMELTGSSADLFNVVLGVAVTTYLFSYLLIIPA
FT                   AAKLRLSEPDVERPFRAGPNWFFILMCVVTTTFVALGSWVSIFPGTLEALVGMPHDFSK
FT                   AQGVSYASFEALTLGTLAFIIVMALIGYWRGAPLRRSGISTESLNQTSTEVHRRERTCD
FT                   "
     MAEVKNSQLT AHNDTDMAKD QTKVLQRTLN RFDIVFLIVS AVVGLEMLGS VSAEGPETFT        60
     WLVFLIIVFL IPYSLIFAET GSAFVGEGGV YLWTRRAFGR PAAAVTSVFT WITQPVWVGG       120
     SMAFLNAEAA RNHLVHFSAG SAGDYLFKLA FIWLTVFAAI LSLAKAKWIP TAGAFFKISF       180
     LCLFLVTAAV YATQHGVQPL SLGSFSPTLR GFITLTPLLL FAFLGFEGGS SASGEMRNAQ       240
     HDVSVSVLRS ATMAGIFYLL PVATILLVLP PSDIDGVSGL LKAVNTVFSV YGPAAEPMMV       300
     LALVMFTLAN IGQGAAWMIM SDRMQAMAAA DGSFFGGFFG KFHPRLGTPV HVNLLSGIVS       360
     TLFMLAAMEL TGSSADLFNV VLGVAVTTYL FSYLLIIPAA AKLRLSEPDV ERPFRAGPNW       420
     FFILMCVVTT TFVALGSWVS IFPGTLEALV GMPHDFSKAQ GVSYASFEAL TLGTLAFIIV       480
     MALIGYWRGA PLRRSGISTE SLNQTSTEVH RRERTCD                                517
//

If you have problems or comments...

PBIL Back to PBIL home page