(data stored in ACNUC30630 zone)

EMBL: CP001977.PE217

CP001977.PE217       Location/Qualifiers
FT   CDS             247540..247662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3221"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3221"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00467"
FT                   /db_xref="UniProtKB/TrEMBL:D4H935"
FT                   /protein_id="ADE00467.1"
FT                   /translation="MYGRIDANNEPSVHLVDDMGFELEQMESVHLQTWSTMLGV"
     MYGRIDANNE PSVHLVDDMG FELEQMESVH LQTWSTMLGV                              40
//

If you have problems or comments...

PBIL Back to PBIL home page