(data stored in ACNUC30630 zone)

EMBL: CP001977.PE22

CP001977.PE22        Location/Qualifiers
FT   CDS             complement(24269..24979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3022"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3022"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00441"
FT                   /db_xref="GOA:D4HEI0"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEI0"
FT                   /protein_id="ADE00441.1"
FT                   /translation="MSIIKGILDVGAVVILPIVMLILCLIFRMPFGKSLKAGLMIGIGF
FT                   SGLSLVIGFLMTSVQSAVDYYRHMGGGFTTVDVGWAAVGAASFGVPFAAPAILLVVLIN
FT                   VVMILAKMTNVLNVDIWNFIRFLVPGTLAYALTNNAWIGLGVVLVLSVIDLIVAQHIAP
FT                   KWQEYYGLTGTTCSTLSYITSAWPIAIGLNWVIDKIPGVRKIDISMEKFGDRLGFFGDT
FT                   AFIGLIVGIFLWDS"
     MSIIKGILDV GAVVILPIVM LILCLIFRMP FGKSLKAGLM IGIGFSGLSL VIGFLMTSVQ        60
     SAVDYYRHMG GGFTTVDVGW AAVGAASFGV PFAAPAILLV VLINVVMILA KMTNVLNVDI       120
     WNFIRFLVPG TLAYALTNNA WIGLGVVLVL SVIDLIVAQH IAPKWQEYYG LTGTTCSTLS       180
     YITSAWPIAI GLNWVIDKIP GVRKIDISME KFGDRLGFFG DTAFIGLIVG IFLWDS           236
//

If you have problems or comments...

PBIL Back to PBIL home page