(data stored in ACNUC30630 zone)

EMBL: CP001977.PE221

CP001977.PE221       Location/Qualifiers
FT   CDS             complement(250855..252753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3225"
FT                   /product="kinase domain protein"
FT                   /note="identified by match to protein family HMM PF00069;
FT                   match to protein family HMM PF03793"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3225"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00096"
FT                   /db_xref="GOA:D4H939"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D4H939"
FT                   /protein_id="ADE00096.1"
FT                   /translation="MSAESWLSGRYELQNLIGRGGMADVWKARDHRLGRDVAVKKLRTD
FT                   LASDDTFQARFQREAQSAARLNHPNIAAVYDTGETKDPATGLPVPFIVMELIDGHTLRD
FT                   VLRDGRKILPRRALEFTQGVLDALSYSHAAGIVHRDIKPANVMLTREGYVKVMDFGIAR
FT                   AVADTSATMTQTAAVIGTAQYLSPEQARGETVDNRADIYATGCLLYELLVGRPPFIGDS
FT                   PVSVAYQHVREVPAPPSSLDAEITHQMDAITLKALAKDPADRYQTAKQMRDDIDRLLSG
FT                   REPFAMQNYADSEADTEEQTHLIPAAATDPIPATAAQQDESSPASAESPQEPEEPHRKR
FT                   WPVIVVTIVVVVLLALLGFGLHKILSSSSQPSPAPTPSRTVKMVKVPAVTGLSQQGATS
FT                   TLENAGLKVQVDHVQRDQATANQVVSQSPAANEKVPAGSDVKITVNDGPKQLTIPRNIV
FT                   GLPKNDALKALKDAGFSDSQIKVTNDDPKTEPNSAKAGAVDAVSPGAGTTLTPDQQVTL
FT                   TIATGKSVVPNLKGMSVEEANSAAGSSGFSISVERQVTSSAAPGTVFGQDPDYGAIANR
FT                   STAIKVLVAVAPPAPEPTREPPTNSAPSEEPSSSSIAPVPPAPTTAVPTTSSSSGR"
     MSAESWLSGR YELQNLIGRG GMADVWKARD HRLGRDVAVK KLRTDLASDD TFQARFQREA        60
     QSAARLNHPN IAAVYDTGET KDPATGLPVP FIVMELIDGH TLRDVLRDGR KILPRRALEF       120
     TQGVLDALSY SHAAGIVHRD IKPANVMLTR EGYVKVMDFG IARAVADTSA TMTQTAAVIG       180
     TAQYLSPEQA RGETVDNRAD IYATGCLLYE LLVGRPPFIG DSPVSVAYQH VREVPAPPSS       240
     LDAEITHQMD AITLKALAKD PADRYQTAKQ MRDDIDRLLS GREPFAMQNY ADSEADTEEQ       300
     THLIPAAATD PIPATAAQQD ESSPASAESP QEPEEPHRKR WPVIVVTIVV VVLLALLGFG       360
     LHKILSSSSQ PSPAPTPSRT VKMVKVPAVT GLSQQGATST LENAGLKVQV DHVQRDQATA       420
     NQVVSQSPAA NEKVPAGSDV KITVNDGPKQ LTIPRNIVGL PKNDALKALK DAGFSDSQIK       480
     VTNDDPKTEP NSAKAGAVDA VSPGAGTTLT PDQQVTLTIA TGKSVVPNLK GMSVEEANSA       540
     AGSSGFSISV ERQVTSSAAP GTVFGQDPDY GAIANRSTAI KVLVAVAPPA PEPTREPPTN       600
     SAPSEEPSSS SIAPVPPAPT TAVPTTSSSS GR                                     632
//

If you have problems or comments...

PBIL Back to PBIL home page