(data stored in ACNUC30630 zone)

EMBL: CP001977.PE224

CP001977.PE224       Location/Qualifiers
FT   CDS             complement(255612..257099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3228"
FT                   /product="protein phosphatase 2C"
FT                   /note="identified by match to protein family HMM PF00481"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3228"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01107"
FT                   /db_xref="GOA:D4H942"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D4H942"
FT                   /protein_id="ADE01107.1"
FT                   /translation="MAFSLDIRCHSEIGLVRRNNQDSGYVSPRMLVVADGMGGAAAGDL
FT                   ASTVAVRHVAKADRRFSGEGSPARPQGEEMLTVLSGAVADANDELADLVAWDSSLEGMG
FT                   TTFCGAMFSGTQLGIVHIGDSRGYLLRQGRMKRMTHDHSWVQSLIDDGRITPEEAAVHP
FT                   HRSLLLKVLNGQPQHIPDTQIVDLRLGDRILFCSDGLCGLVNDDTIGEHLNTTNLDDVV
FT                   DLLTTDAHAGGGTDNITIVVAEVVEADPNLDASEPHIIGAATTRKVPEHEVTAPLPLDQ
FT                   PASATNNDGKSTVLFDSEAEESMRYAPVDSMTRHRRHWLWPVVILAFVAVVVGGIFGAR
FT                   AYLNTQYYVGTDDDTVAIYQGSPDNLAWIQLSHVTEKTNIKTADLPRYYRDRVLGNIRV
FT                   SSMDSAHATVAELRTGAQQCKVIREAATAPPPTKPATPPSTPPQPSASGPTANAHHTPQ
FT                   PSAVPTPAMPTPTSAMPSPSAAGHEVDLPAVTSGDCQ"
     MAFSLDIRCH SEIGLVRRNN QDSGYVSPRM LVVADGMGGA AAGDLASTVA VRHVAKADRR        60
     FSGEGSPARP QGEEMLTVLS GAVADANDEL ADLVAWDSSL EGMGTTFCGA MFSGTQLGIV       120
     HIGDSRGYLL RQGRMKRMTH DHSWVQSLID DGRITPEEAA VHPHRSLLLK VLNGQPQHIP       180
     DTQIVDLRLG DRILFCSDGL CGLVNDDTIG EHLNTTNLDD VVDLLTTDAH AGGGTDNITI       240
     VVAEVVEADP NLDASEPHII GAATTRKVPE HEVTAPLPLD QPASATNNDG KSTVLFDSEA       300
     EESMRYAPVD SMTRHRRHWL WPVVILAFVA VVVGGIFGAR AYLNTQYYVG TDDDTVAIYQ       360
     GSPDNLAWIQ LSHVTEKTNI KTADLPRYYR DRVLGNIRVS SMDSAHATVA ELRTGAQQCK       420
     VIREAATAPP PTKPATPPST PPQPSASGPT ANAHHTPQPS AVPTPAMPTP TSAMPSPSAA       480
     GHEVDLPAVT SGDCQ                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page