(data stored in ACNUC30630 zone)

EMBL: CP001977.PE226

CP001977.PE226       Location/Qualifiers
FT   CDS             complement(257594..258283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3230"
FT                   /product="FHA domain protein"
FT                   /note="identified by match to protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3230"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00017"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:D4H944"
FT                   /protein_id="ADE00017.1"
FT                   /translation="MGFLNKVEKSIEGAVSGVFARAFRGEVEPVEIAGRLQRELDSEAQ
FT                   ILSRDKSLVPNDFVVRLSSRDYERLVPYTKTLNAEIIPTLRDHASERHYVFNGPIHIRY
FT                   DLDDALPVGKFTVLTGENHAKAVSDRRAPLVLEVDGVRHPLTPPGLTIGRGSDADIRIN
FT                   DPGISRLHARINVWPQGNDIGLSIEDLDSTNGVTVNGVKVTSTELGDGSRIEIGSTRML
FT                   VHSPTRI"
     MGFLNKVEKS IEGAVSGVFA RAFRGEVEPV EIAGRLQREL DSEAQILSRD KSLVPNDFVV        60
     RLSSRDYERL VPYTKTLNAE IIPTLRDHAS ERHYVFNGPI HIRYDLDDAL PVGKFTVLTG       120
     ENHAKAVSDR RAPLVLEVDG VRHPLTPPGL TIGRGSDADI RINDPGISRL HARINVWPQG       180
     NDIGLSIEDL DSTNGVTVNG VKVTSTELGD GSRIEIGSTR MLVHSPTRI                   229
//

If you have problems or comments...

PBIL Back to PBIL home page